Protein WP_103234934.1 in Chryseobacterium viscerum 687B-08
Annotation: NCBI__GCF_002899945.2:WP_103234934.1
Length: 240 amino acids
Source: GCF_002899945.2 in NCBI
Candidate for 26 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-asparagine catabolism | bgtA | lo | ATPase (characterized, see rationale) | 38% | 90% | 148.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
L-aspartate catabolism | bgtA | lo | ATPase (characterized, see rationale) | 38% | 90% | 148.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-cellobiose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-galactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-glucose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
lactose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-maltose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-mannose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
sucrose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
trehalose catabolism | glcV | lo | monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) | 40% | 57% | 144.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
L-arabinose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 36% | 60% | 143.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-fructose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 36% | 60% | 143.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
sucrose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 36% | 60% | 143.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-xylose catabolism | araV | lo | AraV, component of Arabinose, fructose, xylose porter (characterized) | 36% | 60% | 143.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
L-glutamate catabolism | gltL | lo | GluA aka CGL1950, component of Glutamate porter (characterized) | 34% | 98% | 142.9 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-maltose catabolism | malK1 | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 39% | 57% | 138.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
trehalose catabolism | thuK | lo | MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) | 39% | 57% | 138.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-cellobiose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-glucose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
lactose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-maltose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
sucrose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
trehalose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 35% | 55% | 133.7 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
citrate catabolism | fecE | lo | iron(III) dicitrate transport ATP-binding protein FecE (characterized) | 31% | 85% | 107.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
glycerol catabolism | glpT | lo | GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) | 32% | 61% | 107.1 | Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- | 45% | 214.9 |
Sequence Analysis Tools
View WP_103234934.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MINIQNISKVYKTEDVQTNALNNVSLSIKEGEFVAIMGPSGCGKSTFLNILGLLDSASSG
SYKFGETETINLNERKKSDIRKKNIGFIFQNFNLIDELTVYENIELPLIYNGVSASERKR
QVEEIMDKINIAHRAKHYPQQLSGGQQQRAAVARALVTKPKLILADEPTGNLDSSNGNEV
MNLLAELHREGSTIAMVTHSSYDAGYASKIVNMKDGEIFSEEHSSQRKDVFEKADAKNFG
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory