GapMind for catabolism of small carbon sources

 

Protein WP_103234934.1 in Chryseobacterium viscerum 687B-08

Annotation: NCBI__GCF_002899945.2:WP_103234934.1

Length: 240 amino acids

Source: GCF_002899945.2 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 38% 90% 148.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 38% 90% 148.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 40% 57% 144.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 60% 143.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 60% 143.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 60% 143.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 60% 143.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
L-glutamate catabolism gltL lo GluA aka CGL1950, component of Glutamate porter (characterized) 34% 98% 142.9 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 39% 57% 138.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 39% 57% 138.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-cellobiose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-glucose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
lactose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-maltose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
sucrose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
trehalose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 35% 55% 133.7 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
citrate catabolism fecE lo iron(III) dicitrate transport ATP-binding protein FecE (characterized) 31% 85% 107.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 61% 107.1 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- 45% 214.9

Sequence Analysis Tools

View WP_103234934.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MINIQNISKVYKTEDVQTNALNNVSLSIKEGEFVAIMGPSGCGKSTFLNILGLLDSASSG
SYKFGETETINLNERKKSDIRKKNIGFIFQNFNLIDELTVYENIELPLIYNGVSASERKR
QVEEIMDKINIAHRAKHYPQQLSGGQQQRAAVARALVTKPKLILADEPTGNLDSSNGNEV
MNLLAELHREGSTIAMVTHSSYDAGYASKIVNMKDGEIFSEEHSSQRKDVFEKADAKNFG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory