GapMind for catabolism of small carbon sources

 

Protein WP_109737982.1 in Chryseobacterium viscerum 687B-08

Annotation: NCBI__GCF_002899945.2:WP_109737982.1

Length: 306 amino acids

Source: GCF_002899945.2 in NCBI

Candidate for 51 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism opuBA med BilEA aka OpuBA protein, component of A proline/glycine betaine uptake system. Also reported to be a bile exclusion system that exports oxgall and other bile compounds, BilEA/EB or OpuBA/BB (required for normal virulence) (characterized) 47% 87% 236.9 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 36% 74% 172.6 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 64% 168.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 64% 168.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 36% 70% 162.5 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 82% 161 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-proline catabolism proV lo glycine betaine/l-proline transport atp-binding protein prov (characterized) 38% 59% 160.6 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 38% 62% 159.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 38% 68% 157.5 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 38% 85% 156 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism malK lo Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 33% 69% 154.5 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 38% 99% 153.7 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 65% 153.7 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 36% 65% 153.7 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 39% 57% 153.7 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 34% 65% 152.1 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) 33% 68% 151 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 37% 61% 150.6 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 34% 67% 146.4 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 37% 65% 146 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 75% 145.2 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 75% 145.2 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 75% 145.2 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 35% 75% 145.2 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 70% 144.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 35% 70% 144.8 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 36% 59% 144.1 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 34% 65% 143.3 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 35% 70% 142.5 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 33% 66% 137.5 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 35% 61% 131 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 30% 93% 121.7 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 30% 68% 118.2 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 74% 110.9 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 32% 61% 107.1 Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA 46% 273.1

Sequence Analysis Tools

View WP_109737982.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKVESISKSFNGKKAVDHISFQAFDQEILVLLGTSGCGKTTTLKMINRLIEADAGNIFI
DGKNIRDQKAEELRMGIGFVMQHSGLFPHYTIQQNIAVVPELLKWDKKKTERRTHELLAK
LHLSEEVLSRFPHELSGGQQQRVGIARALIADSPVLLMDEPFGALDNITKADIHSEFKSL
EDLKNKTIVLVTHDVQEAFDLGHRICLMDQGKIVQTGTPKEILYHPSNHFVRDFFAENRL
LLEYKVATLQHISPFLSPEKSYHELESIDNISVWDVLQQLSSGHQNAEVYEELIRAFNHY
RKSQIV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory