Align MFS transporter (characterized, see rationale)
to candidate WP_103231791.1 C1634_RS07405 MFS transporter
Query= uniprot:A0A1X9ZCC9 (458 letters) >NCBI__GCF_002899945.2:WP_103231791.1 Length = 472 Score = 339 bits (870), Expect = 1e-97 Identities = 181/447 (40%), Positives = 276/447 (61%), Gaps = 16/447 (3%) Query: 8 ENPKLTLVQIINMSVGFFGIQFGWDLQRANMGRIYENLGANPDQVPLLFLAAPLTGLLVQ 67 + P L+++QIINMS+GF GIQ + LQ N RI NLGA+ ++ +L AP+TGL+VQ Sbjct: 17 KKPNLSMLQIINMSMGFLGIQMAFGLQNGNASRILGNLGADVHELSWFWLVAPVTGLIVQ 76 Query: 68 PIIGYLSDRTWHPKWGRRRPYFMIGAIVSSIALIFMPHSS---------VLWMAAGLLWI 118 PIIG++ D TW P GRR+PYF+IGA++ ++ L+ +P+++ L +A L + Sbjct: 77 PIIGHMGDNTWSPL-GRRKPYFLIGAVLCAVGLVLLPNAASVTQMFAANALLLAVIFLAM 135 Query: 119 LDVFGNIAMEPFRAFVTDKLPDSQVNRGFIMQSMMIGLGGSVASALP-WIMNNVFHLTNT 177 +D NIAMEPFRA V D LP Q GF +Q+++IG+G + S LP W+ ++N Sbjct: 136 MDASVNIAMEPFRALVGDMLPKHQGTIGFSVQTILIGIGAVLGSYLPDWLTK--IGISNE 193 Query: 178 AEQGSIPENVKFSFYIGAFFFFAAVLWTVFTTKEYPPQDVDFKEKVKESNKGFGGGAREI 237 A QG + +NV +SFYIGA ++L+T+ TT+EY PQ+ E KE+ K +I Sbjct: 194 APQGFVADNVIYSFYIGAGLLIISILYTIMTTREYSPQEFAEFEDEKEAEK-HESKFSDI 252 Query: 238 FHALRNMPKRMQIVSLVQFFTWPGLFLMWFYYTTAVAVNVFG--GKDAADPVYAQGADFG 295 F ++P +M+ + +VQFF+W LF MW + T+A+A + G +D + D Sbjct: 253 FKDFASIPVQMKKLGIVQFFSWFALFTMWVFTTSALATHHLGLSPEDTHSKAFNDAGDLT 312 Query: 296 SLTLAYYSVITFLFALVLPKIADALGRKTTHALCLICGAIGLISVAWVHDKNMLYLCMTG 355 Y++ FA +L IA +G+K THAL L+CG +GLIS+ ++ + + L++ M G Sbjct: 313 GKLFGMYNLWAIPFAFLLTPIAKLIGKKQTHALALLCGGLGLISMYFIKEVDHLWISMIG 372 Query: 356 VGIAWASILSMPYAMLSGSLPKDKIGIYMGIFNFFIVLPEIIASLGFGWLMRNVLNNDRL 415 +G AWASIL+MPYAML +P+ K+G+YMGIFNFFIV+P+II L G ++ + + Sbjct: 373 LGFAWASILAMPYAMLIDVIPQRKMGVYMGIFNFFIVIPQIINGLFGGPIVSGIFGKQAM 432 Query: 416 LAVQLGGGLMILAAVICYVFIREPKKT 442 V +GG M++ AV+ +F++ +T Sbjct: 433 DYVVVGGVCMLIGAVVTMIFVKSEDET 459 Lambda K H 0.327 0.142 0.448 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 674 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 472 Length adjustment: 33 Effective length of query: 425 Effective length of database: 439 Effective search space: 186575 Effective search space used: 186575 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory