Align Phosphoglucosamine/phosphogalactosamine mutase; PGlcNM; EC 5.4.2.10; EC 5.4.2.13 (characterized)
to candidate WP_103231575.1 C1634_RS03120 phosphoglucosamine mutase
Query= SwissProt::Q976E4 (455 letters) >NCBI__GCF_002899945.2:WP_103231575.1 Length = 460 Score = 240 bits (613), Expect = 6e-68 Identities = 160/462 (34%), Positives = 242/462 (52%), Gaps = 24/462 (5%) Query: 1 MGKLFGTDGVRGI----VNKELTPELVLKLSKAIGTFF--GKNSK---ILVGRDVRAGGD 51 M + G+RG VN LTP V+K + A GT+ KN K +++GRD R G Sbjct: 1 MSLIKSISGIRGTIGGKVNDNLTPLDVVKFASAFGTWLQNNKNKKDLTLIIGRDARISGQ 60 Query: 52 MLVKIVEGGLLSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDK 111 M+ +V L +G+ V D G++ TP ++ V L DGG+++TASHNP +N +K++++ Sbjct: 61 MVSSLVTATLQGLGINVVDLGLSTTPTVEIMVPELNADGGIILTASHNPKQWNALKLLNE 120 Query: 112 DGIEIRREKENEIEDLFFTERFNTIEWSSLTTEVKREDRVISTYVNGILS--HVDIEKIK 169 G I E E+ L +E FN E L RED ++ IL VD E IK Sbjct: 121 KGEFITGENGAEVLALAESEDFNYAEVDDLGQYETRED-AFDIHIKQILDLPMVDAEAIK 179 Query: 170 KKNYKVLIDPANSVGALSTPLVARALGCKIYTINGNLDPL-FSARQPEPTFDSLKETAEV 228 KN+KV++D NS G ++ P++ LGC+ T+ +P PEP + L + E+ Sbjct: 180 AKNFKVVLDAVNSTGGIAIPMLLDTLGCE--TVKLYCEPTGHFPHNPEPLKEHLGDICEL 237 Query: 229 VKTLKVDLGVAHDGDADRAIFIDSEGRVQWGDRSG--TLLSYWASVKNPKAIKKIVTAVS 286 VK DLG+ D D DR ID +G + +G+ + Y KN A+ + S Sbjct: 238 VKKENADLGIVVDPDVDRLALIDEKGEM-FGEEYTLVAVADYLLKHKNGVAVSNL----S 292 Query: 287 SSSLVEEYLSKYNIQVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSF 346 SS + + +N + + VG V++ + ++NA+ G E NGG +YP Y RD + Sbjct: 293 SSRALRDVAHTHNSEYFASAVGEVNVVTLMKEKNAVIGGEGNGGIIYPDLHYGRDSLVGV 352 Query: 347 ALMLELLANENVSSAELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITI 406 AL L LA EN + +EL P Y++ K K++L P + V+ I K+ + Y V + Sbjct: 353 ALFLTHLAKENKTVSELRAGYPSYFMGKKKIELTPEIDVDAILSKMEQEYKNEEVS--VV 410 Query: 407 DGVKIIGKDFWFLVRKSGTEPIIRIMAEAKDENVANNLVNEL 448 DGVKI ++ W +RKS TEPIIRI EAK + A+ L +++ Sbjct: 411 DGVKIDFENNWVHLRKSNTEPIIRIYTEAKSQEEADKLGDDI 452 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 460 Length adjustment: 33 Effective length of query: 422 Effective length of database: 427 Effective search space: 180194 Effective search space used: 180194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory