Align Fructokinase; EC 2.7.1.4 (uncharacterized)
to candidate WP_103231942.1 C1634_RS03565 ROK family protein
Query= curated2:P43468 (288 letters) >NCBI__GCF_002899945.2:WP_103231942.1 Length = 322 Score = 62.4 bits (150), Expect = 1e-14 Identities = 73/297 (24%), Positives = 118/297 (39%), Gaps = 50/297 (16%) Query: 6 IEAGGTKFVCATGAENGQVSDRISIPTTTPVETMTAVDD-YFTTHPV-DAIGIGS-FGPI 62 ++ GGT G+V D+ ++ T + +D Y + P+ + G + F I Sbjct: 14 VDIGGTNTKFGIVNHRGEVLDKGNLRTDAYDKVEDFIDALYESVRPMMEKYGTEAHFDGI 73 Query: 63 GVNPHDPKY--GYITTTPKPGW-GDFDFLGHLKSQFNIPLYWTTDVNEAAYGESMIGIAK 119 GV + Y G I P W G F + ++FN+P T D N AA GE + G A+ Sbjct: 74 GVGAPNANYYKGTIELAPNLPWKGVIPFAELMTAKFNLPCTVTNDANAAALGEMLFGAAR 133 Query: 120 DVPNSIYMTIGTGVGAGVISQNHIFNGRT--HTELGHMRLNRLPGDDFKSNCPYHDICLE 177 + + I +T+GTGVG+G+I+ + G ELGH + PG K + LE Sbjct: 134 GMKDFIMITLGTGVGSGIIANGSLIYGHDGFAGELGHTIVK--PGGR-KHWSTGSEGSLE 190 Query: 178 GLAAGPAVGKRTGKAGKDIP----------------------VDDPVWPIITDY----IA 211 A+ + K + P +DP+ + Y + Sbjct: 191 AYASATGITITAKKMRAEFPESMLNQYPEDEINSKTVYECAMKEDPIAIEVFRYTGQKLG 250 Query: 212 QACVNLTVAFAPDKIILNGGVMN-------------QRQLFPMIREKFAAYLNGYEE 255 +A N + +P I+L GGV+ +R L P+ R K + +E Sbjct: 251 EAIANFVMFSSPQAILLFGGVIKAGDFILKPAKLHMERNLLPIFRNKVQLVFSELDE 307 Lambda K H 0.319 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 322 Length adjustment: 27 Effective length of query: 261 Effective length of database: 295 Effective search space: 76995 Effective search space used: 76995 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory