Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate WP_109739131.1 C1634_RS21995 hydroxyacid dehydrogenase
Query= curated2:A1RYE4 (339 letters) >NCBI__GCF_002899945.2:WP_109739131.1 Length = 309 Score = 171 bits (432), Expect = 3e-47 Identities = 98/294 (33%), Positives = 163/294 (55%), Gaps = 27/294 (9%) Query: 32 KDWPPSREELLRNIRDKDALLCLLTDKIDAEVMDAAPNLKVISTYSVGFDHIDIPEATKR 91 +D+ S +E+ I + D ++ +D ++ NLK I+ G ++IDIP A K Sbjct: 26 EDFTSSYDEVCGKIENYDGIIIRSRIPLDRNFLEKGKNLKFIARVGAGMENIDIPVAEKL 85 Query: 92 GIYVTHTPGVLTDAVAEFTVGLILAVTRRIVEADKIIRTGQWDKPWNPYFLTGPELKGKT 151 GI + ++P D+VAE VG++L + R+ A + ++ G W + N G EL GKT Sbjct: 86 GIQLINSPEGNRDSVAEHVVGMLLVIMNRLFIASQEVKNGIWQREEN----RGDELLGKT 141 Query: 152 IGLVGLGRIGVATAKRLSSFDVKILYYDIERRWDVETVIPNMEF-----TDLDTLLEKSD 206 +GL+G G +G ATAKRLS F K++++DI +P + L+ L + ++ Sbjct: 142 VGLIGYGNMGKATAKRLSGFGCKVVFHDI---------LPGLSDEYGTQVSLEELKQSAE 192 Query: 207 IVSIHVPLTKETYHLINEERLRKMKKTAYLINTARGPVVDTEALVKALKEGWIAGAALDV 266 +VS+H+PLT ET++LI+E + +MK Y +NTARG V T++LV+ALK G + G LDV Sbjct: 193 VVSLHIPLTSETHYLIDETFIAEMKNDFYFVNTARGKNVKTKSLVEALKSGKVKGTCLDV 252 Query: 267 FEQEPLPPNH---------PLTKFDNVVLAPHIASATIEARQRMAELAARNLIA 311 E E + L + + ++ PHIA T ++++++A+ ++A Sbjct: 253 LEYEKSSFENIEVENEDLKYLLESEKAIVTPHIAGWTHQSKEKLAQFIVDKIVA 306 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 309 Length adjustment: 28 Effective length of query: 311 Effective length of database: 281 Effective search space: 87391 Effective search space used: 87391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory