Align alpha-ketoglutarate TRAP transporter, solute receptor component (characterized)
to candidate WP_104485510.1 UN63_RS04125 TAXI family TRAP transporter solute-binding subunit
Query= reanno::psRCH2:GFF85 (317 letters) >NCBI__GCF_002936955.1:WP_104485510.1 Length = 329 Score = 164 bits (415), Expect = 3e-45 Identities = 107/322 (33%), Positives = 164/322 (50%), Gaps = 8/322 (2%) Query: 2 RLTKRLGLLAAAAAFTASTAAVAAPTFINILTGGTSGVYYPIGVALSQQYNK---IDGAK 58 RL GLLAA +A A AA P FI + TGG +GVYYP G A+ + N+ G + Sbjct: 10 RLALTFGLLAALSAPMAGMAA--EPVFITMGTGGMTGVYYPTGGAICRLVNQGRAEHGIR 67 Query: 59 TSVQATKASVENLNLLQAGRGELAFSLGDSVEDAWNGVEDAGFKAPLKRLRAIAGTYNNY 118 SV++T S N+ L+ G EL D A+ G + P + LR++ + Sbjct: 68 CSVESTGGSPHNIASLRRGELELGMVQSDVEYQAYQGTGPFAEQGPYQELRSVFALHGEA 127 Query: 119 IQIVASAESGIKTLDDLKGKRISVGAPKSGTELNARAIFKAAGLDYKDMGRVEFLPYAES 178 + IVA E+ I + +DLKGK++++G P SG ++ +A G + D G+V L AE Sbjct: 128 LTIVARKEANIHSFEDLKGKKVNIGNPGSGHRETMDSLLQAYGWSHDDFGQVSELRPAEH 187 Query: 179 VELIKNRQLDATLQSSGLGMAAIRDLASTMPVTFVEIPAEVVEKI--ESDAYLAGVIPAG 236 + + N ++DA + G +IR+ AS V V I VVEK+ E Y + G Sbjct: 188 SQALCNNRIDAFVYVVGHPNGSIREAASACEVNLVSISDAVVEKLVAEHSYYRPVTLAGG 247 Query: 237 TYDGQDADVPTVAITNILVTHEKVSDEVAYQMTKLMFDNLAALGNAHSAAKDIK-LENAT 295 Y G + ++ T ++ LVTH V + V Y++TK +FD+ H + ++ + Sbjct: 248 QYRGTEEEIHTFEVSANLVTHASVPEPVIYELTKAVFDHFEQFIRMHPSLTSLQPAQMIG 307 Query: 296 KNLPIPLHPGAERFYKEAGVLK 317 L PLHPGA R+++E G L+ Sbjct: 308 VGLSAPLHPGASRYFREKGWLE 329 Lambda K H 0.314 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 329 Length adjustment: 28 Effective length of query: 289 Effective length of database: 301 Effective search space: 86989 Effective search space used: 86989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory