Align BadK (characterized)
to candidate WP_104486761.1 UN63_RS10750 2,3-dehydroadipyl-CoA hydratase
Query= metacyc::MONOMER-943 (258 letters) >NCBI__GCF_002936955.1:WP_104486761.1 Length = 258 Score = 172 bits (436), Expect = 6e-48 Identities = 104/239 (43%), Positives = 138/239 (57%), Gaps = 5/239 (2%) Query: 17 ITLNRPDVLNALNDALMDALGGALLAFDADDGIGAIVIAGNTRAFAAGADIASMAAWSYS 76 ITLNRP+ NAL + + +G L A+ + A+VI GN R FAAGAD+ M + Sbjct: 18 ITLNRPERRNALRNQTLAEIGEVLAGAAANPEVRAVVIGGNLRCFAAGADLEEMR---HL 74 Query: 77 DVYGSNFITRN--WETIRQIRKPVLAAVAGLAYGGGCELALACDIVIAGRSAKFALPEIK 134 D G R W+ I KP++AAV G A G G EL L CD+V+AG A LPEIK Sbjct: 75 DAVGLQQDIRPSLWKRIDDFNKPLIAAVNGYALGAGLELVLHCDLVVAGEGALLGLPEIK 134 Query: 135 LGLLPGAGGTQRLPRAIGKAKAMDMCLSARPLNAEEADRYGLVSRVVDDDRLRDETVALA 194 LG++PGAGGTQRL R IG+ AM M L+ P+ AE A GLVS++ + + LA Sbjct: 135 LGIMPGAGGTQRLSRQIGQQTAMKMVLTGEPMTAERAYELGLVSQLCVPALTDEYALKLA 194 Query: 195 TTIAAFSAPALMALKESLNRAFESTLAEGILFERRELHARFASADAREGIQAFLEKRAP 253 IAA + A+ A K ++ E++L++G+ ER+ + D EGI AFLEKRAP Sbjct: 195 HQIAAQAPLAVQAAKGAIKACQETSLSQGLRQERQAFVWLAGTEDRNEGINAFLEKRAP 253 Lambda K H 0.321 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 258 Length adjustment: 24 Effective length of query: 234 Effective length of database: 234 Effective search space: 54756 Effective search space used: 54756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory