Align neutral amino acid transporter A (characterized)
to candidate WP_104485805.1 UN63_RS05650 dicarboxylate/amino acid:cation symporter
Query= CharProtDB::CH_091534 (532 letters) >NCBI__GCF_002936955.1:WP_104485805.1 Length = 442 Score = 211 bits (538), Expect = 3e-59 Identities = 141/458 (30%), Positives = 229/458 (50%), Gaps = 56/458 (12%) Query: 45 VLLTVS-GVLAGAGLGAALRGLSLSRTQVT--YLAFPGEMLLRMLRMIILPLVVCSLVSG 101 VLL +S G++AG L ++ + V L GE+ + L+M+++PL+ SLV G Sbjct: 14 VLLGMSLGIVAGFIFRTLLGEVAFVQEYVVNGLLQVGGEIFIASLKMLVVPLIFVSLVCG 73 Query: 102 AASL-DASCLGRLGGIAVAYFGLTTLSASALAVALAFIIKPGSGAQTLQSSDLGLEDSGP 160 +SL D S LGRLGG +A++ +TT A +LA+ + + KPG G ++ +++ Sbjct: 74 TSSLKDLSTLGRLGGKTLAFYLVTTAIAISLALLMGNLFKPGDGVDLTAATTFATKEA-- 131 Query: 161 PPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEG 220 S D+ +FP+N PI + +G Sbjct: 132 --------PSLGDVIVGMFPTN------------------------------PINSMAQG 153 Query: 221 MNILGLVLFALVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSK 280 N L +++FA++ G+A+ G GE + F NE M LV+ +M P G+ L+ Sbjct: 154 -NTLQIIVFAVLFGIAISLAGKPGERIAAMFGDFNEVIMKLVTLLMNVAPYGVFCLMAQL 212 Query: 281 IVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAF 340 + + + +L +Y ++HG + +++ FT NP FL + AF Sbjct: 213 FTSLG--LDAIVNLMEYFLVLAGTLLLHGLVTYSIMFRAFTGLNPLTFLKKMEDAVMFAF 270 Query: 341 ATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVE 400 +T SS+AT+P M+ GVD +++ F +P+GAT+NMDG AI Q VA FIAQ N++ Sbjct: 271 STASSNATIPVTMETATRRMGVDNKVAAFTVPLGATINMDGTAIMQGVATAFIAQAFNID 330 Query: 401 LNAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTT 460 L +++TAT +SVG AGVP G++ +A++L +GLP + LI+ VD ++D T Sbjct: 331 LTFNDYLMVIMTATLASVGTAGVPGVGLIMLAMVLNQVGLPVEGIALIIGVDRLLDMIRT 390 Query: 461 VVNVEGDAL---------GAGILHHLNQKATKKGEQEL 489 VN+ GD++ GA + N K E+E+ Sbjct: 391 AVNITGDSVVTCIVGKSEGAMDVARFNNPNAGKREEEI 428 Lambda K H 0.320 0.136 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 532 Length of database: 442 Length adjustment: 34 Effective length of query: 498 Effective length of database: 408 Effective search space: 203184 Effective search space used: 203184 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory