Align Sodium/proton-dependent alanine carrier protein (characterized)
to candidate WP_104486271.1 UN63_RS08095 alanine:cation symporter family protein
Query= SwissProt::P30145 (445 letters) >NCBI__GCF_002936955.1:WP_104486271.1 Length = 497 Score = 496 bits (1276), Expect = e-145 Identities = 254/434 (58%), Positives = 311/434 (71%), Gaps = 7/434 (1%) Query: 1 MIRLVTMGKSSEAGVSSFQALTMSLSGRIGVGNVAGTATGIAYGGPGAVFWMWVITFIGA 60 M+RL+ G++S AG++SFQALT+SLSGR+G GN+AG AT I +GGPGAVFWMW++ F+GA Sbjct: 43 MVRLMFKGEASPAGITSFQALTLSLSGRVGTGNIAGVATAITFGGPGAVFWMWMVAFLGA 102 Query: 61 ATAYVESTWRKFIKRNKTDNTVAVRRSTLKKALAGNGLR----CSRAAIILSMAVLMPGI 116 TA+VEST + K K DN + R G G++ A I+ +L+PG+ Sbjct: 103 GTAFVESTLAQIYKE-KDDNGL-YRGGPAYYIEKGLGMKWYAWTFAFATIIGCGLLLPGV 160 Query: 117 QANSIADSFSNAFGIPKLVTGIFVIAVLGFTIFGGVKRIAKTAEIVVPFMAVGYLFVAIA 176 QANSIA NAFGI V+ V+ +LG IFGGVKRIA +IVVPFMA+GY+ VA Sbjct: 161 QANSIASGIENAFGISTSVSAAVVVVLLGLIIFGGVKRIAHFTQIVVPFMALGYILVAFV 220 Query: 177 IIAANIEKVPDVFGLIFKSAFGADQVFGGILGSAVMWGVKRGLYANEAGQGTGAHPAAAA 236 +IA +IE +PDV GLI SAFG FG ILG A+ WGVKRG+Y+NEAGQGTG HPAAAA Sbjct: 221 VIAMHIEMLPDVVGLIVGSAFGMKAGFGAILGLAIEWGVKRGIYSNEAGQGTGPHPAAAA 280 Query: 237 EVSHPAKQGLVQAFSIYLDVFLVVTATALMILFTGQYNVINEKTGETIVEHLKGVEPGAG 296 EVSHPAKQGLVQ FS+Y+D V TATA MI+ TG YNV+ K GE IVE L GV G G Sbjct: 281 EVSHPAKQGLVQGFSVYVDTLFVCTATAFMIIITGAYNVMG-KAGEVIVEQLPGVSAGPG 339 Query: 297 YTQAAVDTLFPGFGSAFIAIALFFFAFTTMYAYYYIAETNLAYLVRSEKRGTAFFALKLV 356 YTQAAV+++ PGFG F+A+ALFFFAFTT+ AYYYIAETN+AY+ R R F LK+ Sbjct: 340 YTQAAVESVMPGFGGTFVAVALFFFAFTTILAYYYIAETNVAYINRHIHRPWMIFVLKIA 399 Query: 357 FLAATFYGTVKTATTAWAMGDIGLGIMVWLNLIAILLLFKPAYMALKDYEEQLKQGKDPE 416 +A+ YG+VKTA AW +GDIG+G+M WLN++AILLL KPA +ALKDYE Q QG DP Sbjct: 400 LMASVVYGSVKTAELAWGLGDIGVGMMAWLNIVAILLLQKPALIALKDYEAQKAQGLDPT 459 Query: 417 FNASKYGIKNAKFW 430 F+ K GIKNA W Sbjct: 460 FDPIKLGIKNADIW 473 Lambda K H 0.324 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 720 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 497 Length adjustment: 33 Effective length of query: 412 Effective length of database: 464 Effective search space: 191168 Effective search space used: 191168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory