Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_104486565.1 UN63_RS09730 phosphoglycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_002936955.1:WP_104486565.1 Length = 409 Score = 171 bits (432), Expect = 4e-47 Identities = 108/289 (37%), Positives = 156/289 (53%), Gaps = 14/289 (4%) Query: 39 LLEKVREVDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPG 98 L E++++V + ++ + +L+ A KL I + +G + +++ A RGI V N P Sbjct: 47 LKERIKDVHFVGLRSRTQLTEAVLDVADKLVAIGCFCIGTNQVNLSAAEIRGIPVFNAPF 106 Query: 99 VLTDATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGF 158 T + A+L LL + R I E +A GEW+K+ + +GK LGI+G+ Sbjct: 107 SNTRSVAELVLGELLLLLRGIPERNALAHRGEWQKTA-------HHSFEARGKRLGIIGY 159 Query: 159 GRIGQALAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKET 218 G IG L A+G GM++ YY K + + LL SD +SLHVP T +T Sbjct: 160 GHIGIQLGIIAEGIGMQVSYYDIESKLSLGN--ANQVASLQELLNMSDVVSLHVPETPQT 217 Query: 219 YHMIGEKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELF 278 +M+G +EL +MKP AILIN SRG VVD +AL AL IAGA +DVF EP N+E F Sbjct: 218 RNMLGAEELAMMKPGAILINASRGTVVDIDALAAALASKHIAGAAIDVFPVEPKSNDEEF 277 Query: 279 -----KLKNVVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLVN 322 + NV+L PHIG +T EA+E + VA LI ++ + VN Sbjct: 278 VSPLREFDNVILTPHIGGSTQEAQENIGYEVAGKLIKYSDNGSTLSAVN 326 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 409 Length adjustment: 30 Effective length of query: 301 Effective length of database: 379 Effective search space: 114079 Effective search space used: 114079 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory