Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_104487158.1 UN63_RS12905 3-oxoacyl-ACP reductase FabG
Query= reanno::pseudo6_N2E2:Pf6N2E2_5967 (272 letters) >NCBI__GCF_002936955.1:WP_104487158.1 Length = 244 Score = 132 bits (332), Expect = 7e-36 Identities = 84/246 (34%), Positives = 134/246 (54%), Gaps = 13/246 (5%) Query: 22 KVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAEKVETVAAHWRERGADVHALKADVSN 81 KVVL+TGA++GIG A FAS+ A +V + + E ++A+ + GA L +V++ Sbjct: 6 KVVLVTGASRGIGRATAELFASRGATVVGTATSEKGAEAISAYLGDNGA---GLVLNVTD 62 Query: 82 QQDLHAMARHAVERHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCKAVL 141 + ++ + +R+G IDVLVN AG+ + M +++W+ +L + KAVL Sbjct: 63 VESMNQLLETIKQRYGDIDVLVNNAGITRDNLMMRMKDDEWQDILDTNLTSVFRLSKAVL 122 Query: 142 PQMIEQGVGSIINIASTHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIAPG 201 M+++ G I+ I S + G Y AK GL+G +++LG E A +G+ VN ++PG Sbjct: 123 RAMMKKRHGRIVTIGSVVGTMGNAGQANYAAAKAGLIGFSKSLGREVASRGITVNVVSPG 182 Query: 202 YIETQLNVDYWNGFADPYAERQRA--LDLHPPRRIGQPIEVAMTAVFLASDEAPFINASC 259 +IET + E QRA L P +R+G P E+A FLASDEA +I Sbjct: 183 FIETDM--------TRTLNEEQRAAILSQVPTQRLGDPKEIASAVAFLASDEAGYITGET 234 Query: 260 ITIDGG 265 + ++GG Sbjct: 235 LHVNGG 240 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 141 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 244 Length adjustment: 24 Effective length of query: 248 Effective length of database: 220 Effective search space: 54560 Effective search space used: 54560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory