Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate WP_104486997.1 UN63_RS12040 ABC transporter ATP-binding protein
Query= TCDB::Q97VF5 (362 letters) >NCBI__GCF_002936955.1:WP_104486997.1 Length = 326 Score = 192 bits (487), Expect = 1e-53 Identities = 109/317 (34%), Positives = 185/317 (58%), Gaps = 7/317 (2%) Query: 45 ILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAI-RPP 103 +LEV NL V + R + V+DVSF + G+ LG++GESG GK+ ++L + RP Sbjct: 4 LLEVENLAVSFTTEAGRF-RVVDDVSFSLMSGQTLGLVGESGCGKSVTALSLLGLLPRPA 62 Query: 104 GKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPIS-EIFYHEAISH 162 G+++ G+ +F G+D+ ++T ++ ++ I+ + Q ALNPV + ++ + Sbjct: 63 GEVVGGRALFQGLDLLTLTAEQRYRVRGNKIAMIFQEPMTALNPVHTVGRQLMEVYRLHR 122 Query: 163 GEADKKRVIERASELLKLVGLDPARV-LKMYPFQLSGGMKQRVMIALSLLLNPKLILMDE 221 E K+ + A+++L+ VG+ A LK YP QLSGGM+QRVMIA++L P L++ DE Sbjct: 123 PELGKREQKQAAAQMLRQVGIPEAEARLKAYPHQLSGGMRQRVMIAMALACEPDLLICDE 182 Query: 222 PTSALDMLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTE 281 PT+ALD+ Q +L LI+ + + G+ ++++THD+ +AQ+ +++LVMY G E+ Sbjct: 183 PTTALDVTIQAQILHLIRELQKRTGMAVLFITHDLGVVAQVCDQVLVMYAGRSAEQADVF 242 Query: 282 EIIKSPLNPYTSLLVSSIPSL--KGEVKVINVPLDEP-LVSKEKGCPFLARCSKAFGRCK 338 + + P++PYT L+S+IP L G+ ++ + P L ++ GC F RC RC+ Sbjct: 243 TLFERPVHPYTKGLLSAIPRLDQPGKTELATIRGQVPSLEEQQAGCRFANRCPYMTERCQ 302 Query: 339 EELPEIRLVYDRKVRCH 355 + R+ V CH Sbjct: 303 RQPAMERVEEAHHVWCH 319 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 245 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 326 Length adjustment: 29 Effective length of query: 333 Effective length of database: 297 Effective search space: 98901 Effective search space used: 98901 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory