Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate WP_104485386.1 UN63_RS03470 TRAP transporter large permease subunit
Query= TCDB::P74224 (445 letters) >NCBI__GCF_002936955.1:WP_104485386.1 Length = 438 Score = 271 bits (692), Expect = 4e-77 Identities = 160/437 (36%), Positives = 252/437 (57%), Gaps = 16/437 (3%) Query: 10 MMFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIFGIMANGTLLA 69 ++ +G L+ G V +LGGVA+L G F+ + P I + + LLA Sbjct: 9 LLLLGVLISFALGAQVGLALGGVAMLIGYATWGEGIFNIV-----PTTIESTLFSFVLLA 63 Query: 70 IPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATVVAM 129 IP +I++G +L RSGI + + + +++G +RG LA++VI V +M+ A G++ A ++ Sbjct: 64 IPLYIYMGQLLTRSGIGDAMFKASQLVIGRVRGSLAISVIGVCSMIGAMVGIIGAGIMTS 123 Query: 130 GLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGDLFIGSLLPG 189 G I+L ML GY K+LA GVI+A G LG +IPPS+ +I+ + SVG +FI +L+P Sbjct: 124 GSIALRPMLERGYDKKLALGVIMAGGGLGILIPPSIPMILFSSTTQTSVGKMFIAALVPA 183 Query: 190 LMMAGSFALYVLIIAWLKPDLAPALPA-EVRNIGGQELRRRIVQVM--LPPLVLILLVLG 246 L+ LYV+I P AP A +V + R R + + L LI+LVLG Sbjct: 184 LISITVMVLYVVISCKRNPSRAPVGHALDV----PKNARERFITLRDGFMALGLIVLVLG 239 Query: 247 SIFFGIASPTEAGAVGSIGAIALAHFNQRLNWKALWEVCDATLRITSMVMLILLGSTAFS 306 SI GIA+PTE+GA+G +GA+ LA +R K + T + S+ + I+LG++ FS Sbjct: 240 SIITGIATPTESGAIGVVGALLLALMYKRFKLKMMKRSGIETALLVSVAIWIVLGASVFS 299 Query: 307 --LVFRGLEGDRFMFDLLANLPGGQIGFLAISMITIFILGFFIDFFEIAFIVLPLFKPVA 364 + G++G + D A L I + + + + +LGF ID I I PLF P+A Sbjct: 300 NFHLLMGVQG--MVADFAAGLDLPPIMIIIMMQLIMLLLGFIIDEMIIVLICAPLFTPIA 357 Query: 365 EALNLDLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPASLTTGQIYRGAVPFIGLQVL 424 L D IW+G+++ N++ + TPP+GFALFYL+G+AP +T IY+ +PF+ L++ Sbjct: 358 IGLGYDPIWFGILMILNIEIAVQTPPYGFALFYLKGIAPPGVTMMDIYKSVLPFVMLKLG 417 Query: 425 VLLLIIIFPALINWLPS 441 VL+L ++ P ++ WLP+ Sbjct: 418 VLILCMLVPEIVTWLPN 434 Lambda K H 0.331 0.148 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 530 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 438 Length adjustment: 32 Effective length of query: 413 Effective length of database: 406 Effective search space: 167678 Effective search space used: 167678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory