Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate WP_104487353.1 UN63_RS13375 arginine ABC transporter permease ArtQ
Query= uniprot:B2TBJ7 (240 letters) >NCBI__GCF_002936955.1:WP_104487353.1 Length = 215 Score = 147 bits (372), Expect = 1e-40 Identities = 80/215 (37%), Positives = 129/215 (60%), Gaps = 7/215 (3%) Query: 18 LLLAALMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYTTVFRGVPELLVIYLF 77 L+ A++MT+ L L +LA G V L+ A++SRF LR + TTV RG+PE+LV++ Sbjct: 5 LMNASMMTLGLALMSLAAGLVLAILLCGAEMSRFALLRWPATLLTTVLRGLPEILVVFFI 64 Query: 78 YFGGSTLVTSVGQLFGAEG-FVGVPPFVVGALAVGMISGAYQAEVYRSAVLAVSRGELEA 136 YFG + L LF G ++ PF G A+ ++ AY A+ R A+ AV G+ +A Sbjct: 65 YFGSTQL------LFLLTGEYLEFSPFWCGVTALSLLFAAYAAQTLRGALNAVPHGQRQA 118 Query: 137 ARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDSALISVTGLAELLRTSQVAAGS 196 A+++G+P L RI++PQ R ALPG+GN W + LKD+AL+S+ G+ +L+ ++ + Sbjct: 119 AQALGLPPLYTFVRIVLPQTWRHALPGLGNQWLILLKDTALVSLIGVHDLMYQAKAISAR 178 Query: 197 THQYFTFFVVGGALYLIMTSISNRVFNRAEAHVGR 231 T++ FT++ + +YL +T +S + R V R Sbjct: 179 TYEPFTWYGIAALIYLAITVLSQQGLKRLRTRVTR 213 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 215 Length adjustment: 22 Effective length of query: 218 Effective length of database: 193 Effective search space: 42074 Effective search space used: 42074 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory