Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_104488243.1 UN63_RS15425 alpha-ketoacid dehydrogenase subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_002936955.1:WP_104488243.1 Length = 327 Score = 246 bits (629), Expect = 4e-70 Identities = 129/304 (42%), Positives = 194/304 (63%), Gaps = 2/304 (0%) Query: 4 MSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAI 63 +SY +A+ A+++ + D RVFV+GEDVG GG + T GL ++FGE+RV DTPL+ES Sbjct: 6 ISYREAMREAIRDAIHEDPRVFVMGEDVGHYGGCYAVTKGLLQEFGEQRVRDTPLSESGF 65 Query: 64 AGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGV 123 G GIGAA+ GMRPI E+ +F + A++QI++ AA +R+ S P+V+R G G Sbjct: 66 VGAGIGAALGGMRPIVEVMTVNFSLLALDQIVNNAATLRHMSGGQLGVPLVIRMACGAGR 125 Query: 124 HGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGE 183 A HS S+E +A+ PGLK++ P+T DA+ +L A+ D DPVL FEH Y G Sbjct: 126 QLAAQHSHSLENWYAHVPGLKVLAPATLADARYMLAMALADPDPVLLFEHVLLYN-NTGP 184 Query: 184 VPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLD 243 VP + +A V+REG D+++++YG + AL+AAE L+ GI A VVDLR + PLD Sbjct: 185 VPTKKQCPDMHQAVVRREGADLSLVSYGGSLPKALEAAELLQSQGIGAEVVDLRCLRPLD 244 Query: 244 KEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAMPYA 303 + + +KT ++L+V E + GS+ E+ A+++E+C + LDAP +RL ++P +PY Sbjct: 245 TRTLFASVNKTRRLLVVDEGWRTGSLAGEICALVAEYCFWSLDAPPQRLCSAEVP-IPYP 303 Query: 304 PTME 307 +E Sbjct: 304 RHLE 307 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 327 Length adjustment: 28 Effective length of query: 299 Effective length of database: 299 Effective search space: 89401 Effective search space used: 89401 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory