Align L-leucine transaminase; L-isoleucine transaminase (EC 2.6.1.42) (characterized)
to candidate WP_104485880.1 UN63_RS05985 PLP-dependent aminotransferase family protein
Query= reanno::acidovorax_3H11:Ac3H11_1358 (401 letters) >NCBI__GCF_002936955.1:WP_104485880.1 Length = 392 Score = 306 bits (784), Expect = 7e-88 Identities = 171/387 (44%), Positives = 240/387 (62%), Gaps = 7/387 (1%) Query: 15 ARRAERMNPSVIREILKVTEKPGIISLAGGLPSPKTFPVSAFAAASAAVLANDGPAALQY 74 A+R ++ PS IREILKV P +IS AGGLP+P FP A ASA VL N G ALQY Sbjct: 6 AQRFAKVEPSFIREILKVAVNPEVISFAGGLPNPAFFPNEELAVASARVLQNKGNGALQY 65 Query: 75 AASEGYAPLRQAIADFL----PWDVDADQILITTGSQQALDLIAKVLIDENSRVLVETPT 130 +A+EG+APLR+ IA+ V D ILIT GSQQALDL+ KVL++E +++E P Sbjct: 66 SATEGFAPLREYIAERYFQQHGMRVSPDNILITNGSQQALDLLGKVLVNEGDNLIIEEPG 125 Query: 131 YLGALQAFTPMEPSVVAVASDDEGVLIDDLKAKVGTGADKARFLYVLPNFQNPTGRTMTE 190 YLGA+QA + +P+ VA +D+G+ +++L A + D AR LY + NFQNPTG + + Sbjct: 126 YLGAIQALSVYQPNFQGVALNDDGLDLNELDALLAQ-PDHARLLYGVTNFQNPTGLSYSR 184 Query: 191 ARRAALVKAAAELNLPLVEDNPYGDLWFDNPPPAPLTARNPEGCIYMGSFSKVLAPGLRL 250 R A+ + N+ ++EDNPYG+L F+ P+ PE + MGSFSKV+ P RL Sbjct: 185 ENRQAVADRLIKHNVLMIEDNPYGELRFEGEHLPPIAKLAPENVVLMGSFSKVVVPSFRL 244 Query: 251 GFVVAPKAVYPKLLQAKQAADLHTPGYNQRLVAEVMKGNFLDRHVPTIRALYKQQCEAML 310 G+++ P + K+ AKQAADLHT G+ Q+++ ++ N LD H+ IR +Y +Q AM Sbjct: 245 GWMLVPDWLRQKVTIAKQAADLHTNGFVQQVLHAYLQENNLDDHIDRIRTVYGRQKIAME 304 Query: 311 AALTQEMAGLGVEWNRPDGGMFLWVRLPEGMSAIELLPQAVERNVAFVPGAAFYADNADP 370 AL + G+++ RP+GGMFLW++LP+ + A+ L A++ NVAFVPG FY Sbjct: 305 QALLKHCP--GIDFTRPEGGMFLWLKLPQHIDAMALFNLAIKENVAFVPGQPFYVRPDIL 362 Query: 371 RTLRLSFVTSTVEQIATGIAALAAAIR 397 T RLS+ + I GI+ L IR Sbjct: 363 NTARLSYAGADEATIEEGISRLGRVIR 389 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 392 Length adjustment: 31 Effective length of query: 370 Effective length of database: 361 Effective search space: 133570 Effective search space used: 133570 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory