Align butanoyl-CoA dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.109) (characterized)
to candidate WP_104486425.1 UN63_RS08955 electron transfer flavoprotein subunit alpha
Query= BRENDA::Q18AQ5 (336 letters) >NCBI__GCF_002936955.1:WP_104486425.1 Length = 315 Score = 170 bits (430), Expect = 5e-47 Identities = 114/326 (34%), Positives = 173/326 (53%), Gaps = 15/326 (4%) Query: 5 LVVIEQRENVIQTVSLELLGKATEIAKDYDTKVSALLLGSKVEGLIDTLAHYGADEVIVV 64 LV+ E I+ +L L AT + + D L++G + + G +V++ Sbjct: 4 LVIAEHDNGEIKPATLHSLTAATGLGGEIDL----LIMGHDCRVVAEAARGLGIRKVLLA 59 Query: 65 DDEALAVYTTEPYTKAAYEAIKAADPIVVLFGATSIGRDLAPRVSARIHTGLTADCTGLA 124 DD + EP AA A D VL AT+ G++L PRV+A + G+ +D G+ Sbjct: 60 DDASHEHQLAEPC--AALVVSLAGDYSHVLAAATTQGKNLLPRVAALLDVGMVSDVIGIE 117 Query: 125 VAEDTKLLLMTRPAFGGNIMATIVCKDFRPQMSTVRPGVMKKNEPDETKEAVINRFKVEF 184 A+ + RP + GN +AT+ D ++ TVR + P + + + V Sbjct: 118 AADTFR-----RPIYAGNAIATVQSLD-PIKVLTVRATAFEAMPPGDGQAELEVLAPVAG 171 Query: 185 NDADKLVQVVQVIKEAKKQVKIEDAKILVSAGRGMGGKENLDILYELAEIIGGEVSGSRA 244 V E + ++ A++++S GRGMG KEN +L ++A+ + V +RA Sbjct: 172 PSGSCFVGEELATSE---RPELTAARVVISGGRGMGSKENFALLEQVADKLNAAVGATRA 228 Query: 245 TIDAGWLDKARQVGQTGKTVRPDLYIACGISGAIQHIAGMEDAEFIVAINKNPEAPIFKY 304 +DAG+ QVGQTGK V P+LYIA G+SGAIQH+AGM+D++ IVAINK+ EAPIF+ Sbjct: 229 AVDAGFAANDMQVGQTGKIVAPELYIAVGLSGAIQHLAGMKDSKIIVAINKDGEAPIFEV 288 Query: 305 ADVGIVGDVHKVLPELISQLSVAKEK 330 AD G+V D+ VLPEL +L +K Sbjct: 289 ADYGLVADLFDVLPELDKELGKELDK 314 Lambda K H 0.316 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 315 Length adjustment: 28 Effective length of query: 308 Effective length of database: 287 Effective search space: 88396 Effective search space used: 88396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory