Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_104485333.1 UN63_RS03180 ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_2959 (242 letters) >NCBI__GCF_002936955.1:WP_104485333.1 Length = 246 Score = 229 bits (585), Expect = 3e-65 Identities = 128/243 (52%), Positives = 167/243 (68%), Gaps = 20/243 (8%) Query: 16 LQGFGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLRIPAQLYTTLIRGVPD 75 L+G+ LM+G +TI+++ LSLLL+V LGLLGA AKLSS K R A YTT+IRG+PD Sbjct: 4 LKGYEGALMEGAGVTIQVALLSLLLAVTLGLLGALAKLSSFKPARWLATGYTTVIRGIPD 63 Query: 76 LVLMLLIFYSLQTWLTS--------LTDFM-------EW-----EYIEIDPFGAGVITLG 115 LVLM+LIF+ Q L + L D++ EW +Y+EI PF AG+IT+G Sbjct: 64 LVLMMLIFFGGQVLLNNSLYSLNEKLNDWIGGGDPAHEWVGYLPDYVEISPFVAGIITIG 123 Query: 116 FIYGAYFTETFRGAILSVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVM 175 FI+GAY TETFRGAIL+V +G++EAA AYG+ FR ++FPQMMR ALPG+GNNW+V+ Sbjct: 124 FIFGAYMTETFRGAILAVDKGELEAARAYGMNSSLVFRRILFPQMMRHALPGLGNNWLVL 183 Query: 176 LKATALVSIIGLADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNFILRWLERRYAA 235 LK TALVSIIGL D+V+ A A +T F F + A+I+LL T+ S +L+W ER YA Sbjct: 184 LKTTALVSIIGLDDMVRKASLAAGATQLPFTFYMAVAVIFLLFTTLSTSMLKWAERHYAI 243 Query: 236 GAR 238 R Sbjct: 244 QTR 246 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 246 Length adjustment: 24 Effective length of query: 218 Effective length of database: 222 Effective search space: 48396 Effective search space used: 48396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory