Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_104488354.1 UN63_RS15720 triose-phosphate isomerase
Query= SwissProt::P50921 (256 letters) >NCBI__GCF_002936955.1:WP_104488354.1 Length = 250 Score = 272 bits (695), Expect = 6e-78 Identities = 144/252 (57%), Positives = 173/252 (68%), Gaps = 2/252 (0%) Query: 1 MRHPVVMGNWKLNGSKEMVVDLLNGLNAELEGVTGVDVAVAPPALFVDLAERTLTEAGSA 60 MR +VMGNWKLNGSK MV +L+N L A T V VAV PP LF+ A+ LT+ S Sbjct: 1 MRQTLVMGNWKLNGSKTMVAELINALKAPAAETTNVAVAVCPPVLFLGQAQALLTD--SV 58 Query: 61 IILGAQNTDLNNSGAFTGDMSPAMLKEFGATHIIIGHSERREYHAESDEFVAKKFAFLKE 120 I LGAQ+ D++ GAFTG+ SPAM EFG ++++GHSERR H ESD VA KF+ +++ Sbjct: 59 IALGAQDADIHTQGAFTGENSPAMYPEFGVHYVLVGHSERRTLHGESDAMVAAKFSAVQQ 118 Query: 121 NGLTPVLCIGESDAQNEAGETMAVCARQLDAVINTQGVEALEGAIIAYEPIWAIGTGKAA 180 GL PVLCIGE+ Q E GET V RQL VI G+EAL A+IAYEP+WAIGTGK A Sbjct: 119 AGLVPVLCIGETLEQFEKGETQTVVERQLHEVIAHSGIEALANAVIAYEPVWAIGTGKTA 178 Query: 181 TAEDAQRIHAQIRAHIAEKSEAVAKNVVIQYGGSVKPENAAAYFAQPDIDGALVGGAALD 240 T E AQ +HA IR +AE++ VA + I YGGSVK +AA FA DIDGALVGGAAL Sbjct: 179 TPEIAQGVHAAIRGFLAEQNANVAAGIQILYGGSVKGASAAGLFAMEDIDGALVGGAALQ 238 Query: 241 AKSFAAIAKAAA 252 A FAAI +A A Sbjct: 239 ADEFAAIIRAGA 250 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 250 Length adjustment: 24 Effective length of query: 232 Effective length of database: 226 Effective search space: 52432 Effective search space used: 52432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 46 (22.3 bits)
Align candidate WP_104488354.1 UN63_RS15720 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.2089050.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-71 225.9 3.9 3.4e-71 225.7 3.9 1.0 1 NCBI__GCF_002936955.1:WP_104488354.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002936955.1:WP_104488354.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 225.7 3.9 3.4e-71 3.4e-71 1 228 [] 5 240 .. 5 240 .. 0.98 Alignments for each domain: == domain 1 score: 225.7 bits; conditional E-value: 3.4e-71 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftGe 72 lv++n+Kln+s +v+++++ l++ a++++v+vav pp ++l ++ + s i ++Aq+ d++++GaftGe NCBI__GCF_002936955.1:WP_104488354.1 5 LVMGNWKLNGSKTMVAELINALKAPAAETTNVAVAVCPPVLFLGQAQALLTdSVIALGAQDADIHTQGAFTGE 77 79**********************************************999899******************* PP TIGR00419 73 isAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleere.......aartinnv 138 s +m ++G+++vl+gHsErR+l+ e+d ++++k++ +++ gl +v+C+getle+ e + r++ v NCBI__GCF_002936955.1:WP_104488354.1 78 NSPAMYPEFGVHYVLVGHSERRTLHGESDAMVAAKFSAVQQAGLVPVLCIGETLEQFEkgetqtvVERQLHEV 150 *********************************************************9888888888999999 PP TIGR00419 139 attaaaaAlepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaelaa 211 ++ Al ++v+A+EPv++iGtGk++++ a+ v++ +r +l++ +++va +++lyG+sv++a++a l+a NCBI__GCF_002936955.1:WP_104488354.1 151 IAHSGIEALANAVIAYEPVWAIGTGKTATPEIAQGVHAAIRGFLAEQNANVAAGIQILYGGSVKGASAAGLFA 223 99999999***************************************************************** PP TIGR00419 212 qldvdGvLlasavlkae 228 d+dG+L+++a l+a+ NCBI__GCF_002936955.1:WP_104488354.1 224 MEDIDGALVGGAALQAD 240 **************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (250 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.02 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory