Align Probable aspartate aminotransferase; AspAT; EC 2.6.1.1; Transaminase A (uncharacterized)
to candidate WP_104485284.1 UN63_RS02915 pyridoxal phosphate-dependent aminotransferase
Query= curated2:P63499 (429 letters) >NCBI__GCF_002936955.1:WP_104485284.1 Length = 404 Score = 535 bits (1378), Expect = e-156 Identities = 249/400 (62%), Positives = 320/400 (80%), Gaps = 1/400 (0%) Query: 30 QSAKLQDVLYEIRGPVHQHAARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYA 89 +S KL +V Y+IRGPVH+ A RLE EGHRILKLNIGNPAPFGF+AP+ +++DII LP + Sbjct: 6 KSHKLDNVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFDAPEELLKDIIVNLPTS 65 Query: 90 QGYSDSQGILSARRAVVTRYELVPGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLI 149 QGY DS+G+ SAR+AV+ Y+ G D+DD+Y+GNGVSELI M +QALL+NGD++L+ Sbjct: 66 QGYCDSKGLFSARKAVMQYYQQ-KGLRTTDLDDIYIGNGVSELIVMAMQALLNNGDEILV 124 Query: 150 PSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAV 209 PSPDYPLWTA+ +L+GG VHYLCDE W PD+ D++S+IT RT+ +V+INPNNPTGAV Sbjct: 125 PSPDYPLWTAAVTLSGGKAVHYLCDEQADWYPDLDDIKSRITPRTRGIVLINPNNPTGAV 184 Query: 210 YSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHISLASIAPDMLCLTFNGLSKAYRV 269 Y E L +++++AR+++L++ ADEIYDKILYDD H S+ ++ D+L TFNGLSK+YR Sbjct: 185 YGSEFLLEVIEIARQNKLIIFADEIYDKILYDDVAHHSVCTLCDDVLVATFNGLSKSYRA 244 Query: 270 AGYRAGWLAITGPKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALGGHQSIEDLVLPGG 329 AG+R GW+ ++GPK A +IEG+ +L++MRLC NVP QH+IQ ALGG+QSI +LVLPGG Sbjct: 245 AGFRQGWMMLSGPKHQAKGYIEGLEMLSSMRLCANVPMQHSIQAALGGYQSINELVLPGG 304 Query: 330 RLLEQRDIAWTKLNEIPGVSCVKPAGALYAFPRLDPEVYDIDDDEQLVLDLLLSEKILVT 389 RL +QRD AW LNEIPGVSCVKP GA+Y FPRLDP++Y+I DD+++V DLLL EK+L+ Sbjct: 305 RLRQQRDRAWELLNEIPGVSCVKPKGAIYMFPRLDPKMYNIKDDQKMVYDLLLQEKMLLV 364 Query: 390 QGTGFNWPAPDHLRLVTLPWSRDLAAAIERLGNFLVSYRQ 429 QGTGFNWP PDH RLVTLP +L AI RL FL YRQ Sbjct: 365 QGTGFNWPTPDHFRLVTLPRVEELEDAIGRLARFLKHYRQ 404 Lambda K H 0.320 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 593 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 404 Length adjustment: 31 Effective length of query: 398 Effective length of database: 373 Effective search space: 148454 Effective search space used: 148454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory