Align Glutarate 2-hydroxylase; G-2-H; Carbon starvation induced protein D; EC 1.14.11.- (characterized)
to candidate WP_104488452.1 UN63_RS15945 carbon starvation induced protein CsiD
Query= SwissProt::P76621 (325 letters) >NCBI__GCF_002936955.1:WP_104488452.1 Length = 322 Score = 456 bits (1174), Expect = e-133 Identities = 217/300 (72%), Positives = 253/300 (84%) Query: 18 YSGFTLTPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYKSFLRFRVAKILDDLCAN 77 Y GF L PSAQSPRLLEL F EQT K FL AEWP+QALEYKSFLRFRVA++L+DLC Sbjct: 14 YQGFRLAPSAQSPRLLELRFDEQTVKAFLAAAAEWPIQALEYKSFLRFRVAQLLNDLCGQ 73 Query: 78 QLQPLLLKTLLNRAEGALLINAVGVDDVKQADEMVKLATAVAHLIGRSNFDAMSGQYYAR 137 LQPLL+ TL++R G LLI G++ V+QA++MVK TAVAHL+GRSNFDAMSGQYYAR Sbjct: 74 ALQPLLINTLVDRNTGGLLITPEGLNKVEQAEDMVKFTTAVAHLMGRSNFDAMSGQYYAR 133 Query: 138 FVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVLMMKIDEQNMQGGNSLLLHLDDWE 197 FVV+N D SDSYLRQ HRVMELHNDGT+VE+ TDYV+M+K+DEQN++GGNSLLLHLDDWE Sbjct: 134 FVVQNQDTSDSYLRQAHRVMELHNDGTFVEQDTDYVMMLKVDEQNIEGGNSLLLHLDDWE 193 Query: 198 HLDNYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPVMRYIDQFVQPKDFEEGV 257 HLD ++ P+ARR MR+AAPPSKN +KDV+H VFD D+ G+P+M YIDQFVQPKDF+EGV Sbjct: 194 HLDRFYADPMARRVMRWAAPPSKNTTKDVYHAVFDTDRSGQPIMSYIDQFVQPKDFDEGV 253 Query: 258 WLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPHPDLRRELMRQRGYFAYA 317 WL+ELS+A+ETS LSVPVP G FLLINN FWLHGRD+F H LRRELMRQRGYF +A Sbjct: 254 WLAELSEALETSAHRLSVPVPPGSFLLINNHFWLHGRDKFIAHEGLRRELMRQRGYFTHA 313 Lambda K H 0.321 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 322 Length adjustment: 28 Effective length of query: 297 Effective length of database: 294 Effective search space: 87318 Effective search space used: 87318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory