Align Alr3027 protein, component of The 2-oxo monocarboxylate transporter (Pernil et al., 2010). Transports pyruvate which is inhibited by various 2-ketoacids (characterized)
to candidate WP_104485386.1 UN63_RS03470 TRAP transporter large permease subunit
Query= TCDB::Q8YSQ7 (445 letters) >NCBI__GCF_002936955.1:WP_104485386.1 Length = 438 Score = 291 bits (746), Expect = 2e-83 Identities = 171/452 (37%), Positives = 266/452 (58%), Gaps = 30/452 (6%) Query: 3 LAYEWLGPVMFAGALVLLSSGYPVAFSLGGVAILFGLLGIGLGVFDPIFLTAMPQRIFGI 62 ++ E L ++ G L+ + G V +LGGVA+L G G G+F+ + P I Sbjct: 1 MSIELLTGLLLLGVLISFALGAQVGLALGGVAMLIGYATWGEGIFNIV-----PTTIEST 55 Query: 63 MANYTLLAIPYFIFMGAMLEKSGIAERLLETMGILLGRLRGGLALAVVLVGALLAATTGV 122 + ++ LLAIP +I+MG +L +SGI + + + +++GR+RG LA++V+ V +++ A G+ Sbjct: 56 LFSFVLLAIPLYIYMGQLLTRSGIGDAMFKASQLVIGRVRGSLAISVIGVCSMIGAMVGI 115 Query: 123 VAATVVAMGLISLPIMLRYGYNKELATGVIAASGTLGQIIPPSVVLVVLGDQLGISVGDL 182 + A ++ G I+L ML GY+K+LA GVI A G LG +IPPS+ +++ SVG + Sbjct: 116 IGAGIMTSGSIALRPMLERGYDKKLALGVIMAGGGLGILIPPSIPMILFSSTTQTSVGKM 175 Query: 183 FIGSVIPGLMMASAFALHVLIVAFIRPDVAPA-----LPAQVRE------IGGKALGKRV 231 FI +++P L+ + L+V+I P AP +P RE G ALG Sbjct: 176 FIAALVPALISITVMVLYVVISCKRNPSRAPVGHALDVPKNARERFITLRDGFMALG--- 232 Query: 232 IQVMIPPLILILLVLGSIFFGFATPTEAGAVGCAGAIALAAANGQFTLESLRQVCDTTLR 291 LI+LVLGSI G ATPTE+GA+G GA+ LA +F L+ +++ T Sbjct: 233 ---------LIVLVLGSIITGIATPTESGAIGVVGALLLALMYKRFKLKMMKRSGIETAL 283 Query: 292 ITSMVVFILIGSTAFSLVFRGLNGDQFMF-DVLANLPGGKIGFLFVSMTTVFLLGFFIDF 350 + S+ ++I++G++ FS F L G Q M D A L I + + + LLGF ID Sbjct: 284 LVSVAIWIVLGASVFS-NFHLLMGVQGMVADFAAGLDLPPIMIIIMMQLIMLLLGFIIDE 342 Query: 351 FEIAFIVIPLFVPVAQKLGIDLVWYGVILGANLQTSFLTPPFGFALFYLRGVAPPEVTTS 410 I I PLF P+A LG D +W+G+++ N++ + TPP+GFALFYL+G+APP VT Sbjct: 343 MIIVLICAPLFTPIAIGLGYDPIWFGILMILNIEIAVQTPPYGFALFYLKGIAPPGVTMM 402 Query: 411 DIYRGVIPFILLQLLVLLLIIIFPGIVSFLPS 442 DIY+ V+PF++L+L VL+L ++ P IV++LP+ Sbjct: 403 DIYKSVLPFVMLKLGVLILCMLVPEIVTWLPN 434 Lambda K H 0.331 0.149 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 438 Length adjustment: 32 Effective length of query: 413 Effective length of database: 406 Effective search space: 167678 Effective search space used: 167678 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory