Align High-affinity branched-chain amino acid transport system permease protein BraD, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_104486935.1 UN63_RS11725 high-affinity branched-chain amino acid ABC transporter permease LivH
Query= TCDB::P21627 (307 letters) >NCBI__GCF_002936955.1:WP_104486935.1 Length = 307 Score = 431 bits (1107), Expect = e-125 Identities = 222/306 (72%), Positives = 259/306 (84%), Gaps = 2/306 (0%) Query: 2 PEIYHYLQQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIAITLLA 61 P +Y ++QQL+NGLT+GSTYALIAIGYTMVYGIIGMINFAHGEVYMIG+Y AF+ +T L Sbjct: 4 PTLY-FIQQLLNGLTIGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGAYAAFMVMTGLM 62 Query: 62 MMGLDSVPLMMLAAFAASIIVTSAFGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNAV 121 M+G+DS L++ AAF SI +TS +GYSIERVAYRPLRG RLI LISAIGMSIFLQN + Sbjct: 63 MIGIDSTWLLLTAAFLVSITLTSVYGYSIERVAYRPLRGSKRLIALISAIGMSIFLQNMM 122 Query: 122 MLSQDSKEKAIPTLLPGNFVFGESSMNGVVISYMQILIFVVTFLVMFGLTLFISRSRLGR 181 LSQ S++ A+P+L+PG + FGES +SYMQ++IF+VTF+ M L+LFISRSR+GR Sbjct: 123 RLSQGSRDIAMPSLIPGGWTFGESGFQAS-LSYMQLIIFIVTFVAMTLLSLFISRSRMGR 181 Query: 182 ACRACAEDLKMTNLLGINSNNIIALTFVIGAALAAVAAVLLGMQYGVINPGIGFLAGIKA 241 ACRACAEDLKM NLLGINSN +IALTFVIGAALAAVA VLLG YGVINP IGF+AG+KA Sbjct: 182 ACRACAEDLKMANLLGINSNTVIALTFVIGAALAAVAGVLLGSYYGVINPYIGFMAGLKA 241 Query: 242 FTAAVLGGIGSIPGAMLGGLLLGVAEAFGADVFGDQYKDVVAFGLLILVLLFRPTGILGR 301 FTAAVLGGIGSIPGA++GG+LLGV EA F +YKDVV+FGLLI VLLF PTGILG+ Sbjct: 242 FTAAVLGGIGSIPGAVIGGILLGVTEAMTGAYFSTEYKDVVSFGLLIAVLLFMPTGILGK 301 Query: 302 PEVEKV 307 PEVEKV Sbjct: 302 PEVEKV 307 Lambda K H 0.328 0.145 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory