Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_104914115.1 C3B54_RS08500 phosphate acetyltransferase
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_002950575.1:WP_104914115.1 Length = 707 Score = 384 bits (986), Expect = e-111 Identities = 194/323 (60%), Positives = 249/323 (77%) Query: 5 LFENWLLKRARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERATELGL 64 +FE LL+RA+++ HIVLPEG DDRI+ AA LL + + +T+LGD +I+ RA+ELG+ Sbjct: 379 MFEYDLLERAKSDLKHIVLPEGSDDRIIRAAATLLARGVVRLTLLGDEQEIRSRASELGV 438 Query: 65 HLNTAYLVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIMKDISYFGTMMVHNGDADGM 124 L A +++P + E FA ++ LR+ K +T+++AR+I+ D+S+FGTMMVH ADGM Sbjct: 439 SLEGANVLSPFDEGLRERFAAEYFRLREHKGMTVEQARDIVVDVSFFGTMMVHLALADGM 498 Query: 125 VSGAANTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQLGEI 184 VSGA NTTAHTI PSFQIIKT P SVVSS+F M L R+ +GDCAV P PTAE+L +I Sbjct: 499 VSGAVNTTAHTITPSFQIIKTTPGVSVVSSVFFMCLADRVLVYGDCAVVPEPTAEELADI 558 Query: 185 AVVSAKTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDGPLQFDA 244 A +A+TAAQFGI+PRVA+LSYSTG SG G++V++ A A R+L P+L ++GP+Q+DA Sbjct: 559 AAGAAQTAAQFGIEPRVAMLSYSTGESGRGTEVEKVRTATALLRKLRPDLPIEGPIQYDA 618 Query: 245 AVDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRTGHALAVGPILQGLNKPVND 304 A +P VAR KMPDSDVAG+A VF+FPDL GN YK QR+ A+A+GP+LQGLNKPVND Sbjct: 619 AAEPTVARTKMPDSDVAGRATVFVFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVND 678 Query: 305 LSRGATVPDIVNTVAITAIQAGG 327 LSRGATV DIVNTVAITAIQA G Sbjct: 679 LSRGATVRDIVNTVAITAIQAQG 701 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 589 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 707 Length adjustment: 34 Effective length of query: 295 Effective length of database: 673 Effective search space: 198535 Effective search space used: 198535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_104914115.1 C3B54_RS08500 (phosphate acetyltransferase)
to HMM TIGR00651 (pta: phosphate acetyltransferase (EC 2.3.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00651.hmm # target sequence database: /tmp/gapView.2395284.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00651 [M=304] Accession: TIGR00651 Description: pta: phosphate acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-123 398.1 0.0 2.2e-123 397.6 0.0 1.2 1 NCBI__GCF_002950575.1:WP_104914115.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002950575.1:WP_104914115.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 397.6 0.0 2.2e-123 2.2e-123 1 304 [] 395 696 .. 395 696 .. 0.99 Alignments for each domain: == domain 1 score: 397.6 bits; conditional E-value: 2.2e-123 TIGR00651 1 ivlPEgseervlkAaallaekkiaekvllvnkeeevknkakevnlklgkvvvedpdvskdiekyverlyekrk 73 ivlPEgs+ r+++Aaa+l+ +++++ +ll++++e+ + +a+e+ +l+ +v p +e+++ +++ +r NCBI__GCF_002950575.1:WP_104914115.1 395 IVLPEGSDDRIIRAAATLLARGVVRLTLLGDEQEIRS-RASELGVSLEGANVLSPFDEGLRERFAAEYFRLRE 466 8****************************99988877.9*************99999999************* PP TIGR00651 74 hkGvtekeareqlrDevslaallvelgeadglvsGavsttaktlrpalqiiktlegvklvssvfimekeeevl 146 hkG+t ++ar+ + D + +++++v+l adg+vsGav+tta+t+ p++qiikt++gv++vssvf+m++ ++vl NCBI__GCF_002950575.1:WP_104914115.1 467 HKGMTVEQARDIVVDVSFFGTMMVHLALADGMVSGAVNTTAHTITPSFQIIKTTPGVSVVSSVFFMCLADRVL 539 ************************************************************************* PP TIGR00651 147 vfaDCavavdPnaeeLAeiAlqsaksakslgeeepkvallsystkgsgkgeevekvkeAvkilkekepdllld 219 v++DCav+++P+aeeLA+iA +a++a ++g +ep+va+lsyst+ sg+g evekv+ A+++l++ +pdl ++ NCBI__GCF_002950575.1:WP_104914115.1 540 VYGDCAVVPEPTAEELADIAAGAAQTAAQFG-IEPRVAMLSYSTGESGRGTEVEKVRTATALLRKLRPDLPIE 611 *******************************.***************************************** PP TIGR00651 220 GelqfDaAlvekvaekkapesevagkanvfvFPdLdaGnigYkivqRladaeaiGPilqGlakPvnDLsRGas 292 G++q+DaA ++va+ k+p+s vag+a+vfvFPdL++Gn++Yk+vqR+a+a aiGP+lqGl+kPvnDLsRGa+ NCBI__GCF_002950575.1:WP_104914115.1 612 GPIQYDAAAEPTVARTKMPDSDVAGRATVFVFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVNDLSRGAT 684 ************************************************************************* PP TIGR00651 293 vedivnvviita 304 v divn+v+ita NCBI__GCF_002950575.1:WP_104914115.1 685 VRDIVNTVAITA 696 **********97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (707 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 33.28 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory