Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_104913346.1 C3B54_RS03975 aldehyde dehydrogenase family protein
Query= BRENDA::B6ECN9 (505 letters) >NCBI__GCF_002950575.1:WP_104913346.1 Length = 486 Score = 327 bits (839), Expect = 5e-94 Identities = 195/471 (41%), Positives = 273/471 (57%), Gaps = 21/471 (4%) Query: 13 LFIDGEWREPLKKNRLPIINPANEEIIGYIPAATEEDVDMAVKAARSALRRDDWGSTTGA 72 LFI+GE+R P + I+PA EE++ A+EEDVD A+ AR+A + W G Sbjct: 24 LFINGEFR-PGRGGVFDSISPATEEVLTRFSEASEEDVDYAIGQARAAYDKV-WSKMPGR 81 Query: 73 QRAKYLRAIAAKVLEKKPELATLETIDNGKPWFEAAS-DIDDVVACFEYYADLAEALDSK 131 +R+KYL IA V E+ ELA ET+DNGKP E DI V A F YYA A+ L+ Sbjct: 82 ERSKYLFRIARIVQERSRELAIAETMDNGKPIKETRDVDIPLVAAWFFYYAGWADKLEEA 141 Query: 132 KQTEVKLHLDSFKTHVLREPLGVVGLITPWNYPLLMTTWKVAPALAAGCAAILKPSELAS 191 S + H GVVG + PWN+PL+M WKVAPALAAG +LKP+E S Sbjct: 142 T--------GSHQPHAW----GVVGQVIPWNFPLMMLAWKVAPALAAGNTVVLKPAETTS 189 Query: 192 ITSLELGEICREVGLPPGALSILTGLGHEAGSPLVSHPDVDKIAFTGSGPTGVKIMTAAA 251 +T++ EIC++ G+P G ++I+TG G G LVSH +DK+AFTGS P G +I A Sbjct: 190 VTAMLFAEICQQAGVPAGVVNIVTGAG-ATGRALVSHAGIDKVAFTGSTPVGREIAKTLA 248 Query: 252 QLVKPVTLELGGKSPIVVFDDIHNLDTAVEWTLFGCFWTNGQICSATSRLIIQETIAPQF 311 +TLELGGK +VFDD +D AVE + G F+ G +C A SRL++QE + + Sbjct: 249 GRPTALTLELGGKGANIVFDDAA-MDEAVEGIISGIFFNQGHVCCAGSRLLVQENVHDEL 307 Query: 312 LARLLEWTKNIKISDPLEEDCKLGPVISRGQYEKILKFISTAKDEGATILYGGDR-PEHL 370 LARL + +++ DPL+++ +G + SR Q + I + DEGA+I PE Sbjct: 308 LARLTSRIQTLRLGDPLDKNTDIGAINSRAQLDTISTLTQSGVDEGASIWQSDCALPE-- 365 Query: 371 KKGYYIQPTIITDVDTSMEIWKEEVFGPVLCVKTFKTEEEAIELANDTKFGLGAAILSKD 430 +G++ PT+ TDV TS I ++E+FGPVL V TF+T +EA+ AN+T +GL A + ++ Sbjct: 366 -RGFWFPPTVFTDVSTSHRIAQDEIFGPVLSVLTFRTPDEAVAKANNTPYGLSAGVWTEK 424 Query: 431 LERCERFTKAFQSGIVWINCSQPCFWQPPWGGKKRSGFGRELGEWSLENYL 481 R ++G+VW N P+GG + SG+GRE G L +YL Sbjct: 425 ASRMLAVVDRLRAGVVWSNTFNKFDPTSPFGGYQESGYGREGGLPGLLSYL 475 Lambda K H 0.318 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 626 Number of extensions: 29 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 486 Length adjustment: 34 Effective length of query: 471 Effective length of database: 452 Effective search space: 212892 Effective search space used: 212892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory