Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate WP_104912907.1 C3B54_RS01360 SDR family oxidoreductase
Query= BRENDA::P9WN67 (314 letters) >NCBI__GCF_002950575.1:WP_104912907.1 Length = 311 Score = 168 bits (425), Expect = 2e-46 Identities = 110/317 (34%), Positives = 158/317 (49%), Gaps = 19/317 (5%) Query: 1 MRALVTGAAGFIGSTLVDRLLADGHSVVGLDNFATGRATNLEHLADNSAHVFVEADIVTA 60 MR LVTG AGF+GS L DRLLADGH V+ DNF TG N+ HL + + D VT Sbjct: 1 MRILVTGGAGFLGSHLSDRLLADGHEVIVADNFFTGSKKNIWHLHNQQNFEVIRHD-VTF 59 Query: 61 DLHAILEQHRPEVVFHLAAQIDVRRSVADPQFDAAVNVIGTVRLAEAARQTGVRKIVHTS 120 L+ + +++LA+ DP +V+G + + A++ GVR + + Sbjct: 60 PLYL-----EVDAIYNLASPASPIHYQRDPVQTTKTSVLGAINMLGLAKRLGVR--IFQA 112 Query: 121 SGGSIYGTPPEYPTPET-----APTDPASPYAAGKVAGEIYLNTFRHLYGLDCSHIAPAN 175 S +YG P +P PE+ P P + Y GK A E + +GL N Sbjct: 113 STSEVYGDPEVHPQPESYWGKVNPIGPRACYDEGKRAAETLFFDYHRQHGLAIRVARIFN 172 Query: 176 VYGPRQDPHGEAGVVAIFAQALLSGKPTRVFGDGTNTRDYVFVDDVVDAFVRV---SADV 232 YGPR P + VV+ F L G+P ++GDG+ TR + +V D+VD FVR+ D+ Sbjct: 173 TYGPRMAP-DDGRVVSNFVLQALRGEPLTIYGDGSQTRSFCYVSDLVDGFVRLMDNDQDL 231 Query: 233 GGGLRFNIGTGKETSDRQLHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAERVLGWR 292 G + N+G E + +L AV G ++ P D K+ DI LA LGW Sbjct: 232 VGPV--NLGNPGEFTMNELAEAVLEVTGSKSSIDYRPLPEDDPKQRKPDISLATSALGWE 289 Query: 293 PQIELADGVRRTVEYFR 309 P ++L +G+ TV+YFR Sbjct: 290 PGVQLREGLDHTVQYFR 306 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 311 Length adjustment: 27 Effective length of query: 287 Effective length of database: 284 Effective search space: 81508 Effective search space used: 81508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory