Align Glucosamine-6-phosphate deaminase; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase; EC 3.5.99.6 (characterized)
to candidate WP_104913070.1 C3B54_RS02335 glucosamine-6-phosphate deaminase
Query= SwissProt::Q9K487 (261 letters) >NCBI__GCF_002950575.1:WP_104913070.1 Length = 264 Score = 255 bits (652), Expect = 6e-73 Identities = 128/258 (49%), Positives = 176/258 (68%), Gaps = 1/258 (0%) Query: 2 EVVIVPDAKAGGELIAEAMAQLLRRKPDALLGVATGSTPLPVYEALAAKVRSGAVDTAQA 61 EVV+V + L AE + +R KP LGVATG+TP+ +Y +A + +D + Sbjct: 3 EVVVVDSPDSASALAAELILSKVRTKPALRLGVATGATPVSLYRQMAVLAKQFGIDLGEL 62 Query: 62 RIAQLDEYVGLPAEHPESYRSVLRREVLEPLGIDMDAFMGPDGTAADVQAACEAYDTALG 121 + LDEYVGL P+S+R L +E LG+D + + P G A + A + ++ A+ Sbjct: 63 QAYALDEYVGLEPGSPQSFRHFLEEHFIEVLGLDPNCLVVPSGDVATIATAGDHFEKAIL 122 Query: 122 GSGGVDLQLLGIGTDGHIGFNEPCSSLASRTRIKTLTEQTRIDNARFFDGDIEQVPHHVI 181 +GG+D Q+LGIG++GHIGFNEP SSL SRTR+KTLTE TR DN +F E VP H I Sbjct: 123 DTGGIDCQILGIGSNGHIGFNEPGSSLGSRTRVKTLTENTRRDNGAYF-SQPEDVPVHCI 181 Query: 182 TQGIGTILEARHVVLLATGEGKADAVAASVEGPVAAVCPASALQLHPHATVVVDEAAASK 241 +QGIGTILEAR +V+LA G+ KA+AVA++VEGP++A CPASA+QLHPHATV++DE AAS+ Sbjct: 182 SQGIGTILEARSLVMLAFGDKKAEAVASAVEGPISASCPASAIQLHPHATVILDEGAASR 241 Query: 242 LKLADYFRHTYAHKPDWQ 259 L+ Y++ + +KPDWQ Sbjct: 242 LEQLRYYKFVWENKPDWQ 259 Lambda K H 0.317 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 227 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 264 Length adjustment: 25 Effective length of query: 236 Effective length of database: 239 Effective search space: 56404 Effective search space used: 56404 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory