Align Polyphosphate glucokinase; Poly(P) glucokinase; ATP-dependent glucokinase; Polyphosphate--glucose phosphotransferase; EC 2.7.1.63; EC 2.7.1.2 (characterized)
to candidate WP_104913435.1 C3B54_RS04510 ROK family protein
Query= SwissProt::A5U654 (265 letters) >NCBI__GCF_002950575.1:WP_104913435.1 Length = 254 Score = 209 bits (533), Expect = 4e-59 Identities = 106/242 (43%), Positives = 156/242 (64%), Gaps = 4/242 (1%) Query: 18 RHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRG-- 75 +H GIDVGG+GIKG +VD G+L+ +RIK TP+ TP + + IA++V+ G Sbjct: 4 QHAVGIDVGGTGIKGALVDTQAGELLSERIKYPTPEGGTPGDIFEVIAQIVDDCGPDAAG 63 Query: 76 -PLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTILNDADAAGLAETRY 134 PLGV P VV +G TAAN+ W+G +A + + LG + + LNDAD+AG+AE Y Sbjct: 64 LPLGVCVPSVVKNGRTLTAANISTEWVGLDAEEALEDRLG-RDIVFLNDADSAGVAEAHY 122 Query: 135 GAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWT 194 G GL +L T GTGIGSA+I +G LIPNTE GHLE+ G+ AE R+++ +++ + Sbjct: 123 GEAVGQEGLTILTTLGTGIGSALIQDGVLIPNTELGHLELDGEVAEHRSSAVARQRLGQS 182 Query: 195 YPKWAKQVIRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVG 254 + +WA + R + + PDLF+ GGG+S++AD+++ L+ P+ AAL+N AGI+G Sbjct: 183 FEQWAAGLERYYLHLNRLFSPDLFLLGGGVSKEADQFLHLISLPVPIRTAALRNNAGILG 242 Query: 255 AA 256 AA Sbjct: 243 AA 244 Lambda K H 0.314 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 254 Length adjustment: 24 Effective length of query: 241 Effective length of database: 230 Effective search space: 55430 Effective search space used: 55430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory