Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_104913242.1 C3B54_RS03360 sugar ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_002950575.1:WP_104913242.1 Length = 266 Score = 195 bits (496), Expect = 7e-55 Identities = 107/249 (42%), Positives = 156/249 (62%), Gaps = 9/249 (3%) Query: 4 EPILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEI 63 EP+L+ R + K +G V+AL + D+YPGE++A++GDNGAGKS+++K ++G DEG I Sbjct: 9 EPVLSMRMISKHFGAVSALSDVNLDVYPGEVVALVGDNGAGKSTLVKILAGVHAQDEGTI 68 Query: 64 RLEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDR 123 GK ++ +P ++ +AGI TV+Q+LAL L + N+FLGREI LD Sbjct: 69 TFAGKEVEIHNPHDSLEAGIATVFQDLALCDNLDVVSNLFLGREISPV--------RLDE 120 Query: 124 AAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALG 183 ME +A L EL I ++ V +LSGGQRQ VA+AR+ K++++DEPTAALG Sbjct: 121 ITMELRAWELLRELS-AKIPSVRIPVASLSGGQRQTVAIARSLLGEPKLIMLDEPTAALG 179 Query: 184 VKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSDA 243 V+++ VL LI +R RGL ++++SHNM V VADR+ + RLG P T D Sbjct: 180 VEQTAEVLNLIERLRERGLAVIVVSHNMDDVLAVADRVVVLRLGSNNGEFVPSAATKDDI 239 Query: 244 VAFMTGAKE 252 VA +TG+ + Sbjct: 240 VAAITGSAD 248 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 266 Length adjustment: 25 Effective length of query: 235 Effective length of database: 241 Effective search space: 56635 Effective search space used: 56635 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory