Align NAD(P)+ L-lactaldehyde dehydrogenase (EC 1.2.1.22) (characterized)
to candidate WP_104913346.1 C3B54_RS03975 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-16244 (495 letters) >NCBI__GCF_002950575.1:WP_104913346.1 Length = 486 Score = 382 bits (982), Expect = e-110 Identities = 202/475 (42%), Positives = 295/475 (62%), Gaps = 12/475 (2%) Query: 22 GLFINNEFVQSKSKKTFGTVSPSTEEEITQVYEAFSEDIDDAVEAATAAFHSSWSTSDPQ 81 GLFIN EF + F ++SP+TEE +T+ EA ED+D A+ A AA+ WS + Sbjct: 23 GLFINGEFRPGRGG-VFDSISPATEEVLTRFSEASEEDVDYAIGQARAAYDKVWSKMPGR 81 Query: 82 VRMKVLYKLADLIDEHADTLAHIEALDNGKSLMCSKG-DVALTAAYFRSCAGWTDKIKGS 140 R K L+++A ++ E + LA E +DNGK + ++ D+ L AA+F AGW DK++ Sbjct: 82 ERSKYLFRIARIVQERSRELAIAETMDNGKPIKETRDVDIPLVAAWFFYYAGWADKLE-- 139 Query: 141 VIETGDTHFNYTRREPIGVCGQIIPWNFPLLMASWKLGPVLCTGCTTVLKTAESTPLSAL 200 E +H + GV GQ+IPWNFPL+M +WK+ P L G T VLK AE+T ++A+ Sbjct: 140 --EATGSH----QPHAWGVVGQVIPWNFPLMMLAWKVAPALAAGNTVVLKPAETTSVTAM 193 Query: 201 YLASLIKEAGAPPGVVNVVSGFGPTAGAPISSHPKIKKVAFTGSTATGRHIMKAAAESNL 260 A + ++AG P GVVN+V+G G T G + SH I KVAFTGST GR I K A Sbjct: 194 LFAEICQQAGVPAGVVNIVTGAGAT-GRALVSHAGIDKVAFTGSTPVGREIAKTLA-GRP 251 Query: 261 KKVTLELGGKSPNIVFDDADVKSTIQHLVTGIFYNTGEVCCAGSRIYVQEGIYDKIVSEF 320 +TLELGGK NIVFDDA + ++ +++GIF+N G VCCAGSR+ VQE ++D++++ Sbjct: 252 TALTLELGGKGANIVFDDAAMDEAVEGIISGIFFNQGHVCCAGSRLLVQENVHDELLARL 311 Query: 321 KNAAESLKIGDPFKEDTFMGAQTSQLQLDKILKYIDIGKKEGATVITGGERFGNKGYFIK 380 + ++L++GDP ++T +GA S+ QLD I G EGA++ +G++ Sbjct: 312 TSRIQTLRLGDPLDKNTDIGAINSRAQLDTISTLTQSGVDEGASIWQSDCALPERGFWFP 371 Query: 381 PTIFGDVKEDHQIVRDEIFGPVVTITKFKTVEEVIALANDSEYGLAAGVHTTNLSTAISV 440 PT+F DV H+I +DEIFGPV+++ F+T +E +A AN++ YGL+AGV T S ++V Sbjct: 372 PTVFTDVSTSHRIAQDEIFGPVLSVLTFRTPDEAVAKANNTPYGLSAGVWTEKASRMLAV 431 Query: 441 SNKINSGTIWVNTYNDFHPMVPFGGYSQSGIGREMGEEALDNYTQVKAVRIGLSQ 495 +++ +G +W NT+N F P PFGGY +SG GRE G L +Y + +V G Q Sbjct: 432 VDRLRAGVVWSNTFNKFDPTSPFGGYQESGYGREGGLPGLLSYLRPHSVPAGGKQ 486 Lambda K H 0.316 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 613 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 486 Length adjustment: 34 Effective length of query: 461 Effective length of database: 452 Effective search space: 208372 Effective search space used: 208372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory