Align threonine ammonia-lyase (EC 4.3.1.19) (characterized)
to candidate WP_104913117.1 C3B54_RS02615 threonine ammonia-lyase
Query= BRENDA::Q74FW6 (402 letters) >NCBI__GCF_002950575.1:WP_104913117.1 Length = 419 Score = 335 bits (860), Expect = 1e-96 Identities = 176/375 (46%), Positives = 251/375 (66%), Gaps = 5/375 (1%) Query: 26 SHHFSEKLGIPIYFKCENLQRTGAFKIRGALNFMTSQPREALAKGVITASAGNHAQGVAF 85 S + E LG+P++ KCENLQRTG++KIRGA N M+ E A+GV+ ASAGNHAQGVAF Sbjct: 40 SRYLEELLGVPVFMKCENLQRTGSYKIRGAFNRMSKLSEEERARGVVAASAGNHAQGVAF 99 Query: 86 SADLLGVPSTVFMPESTPPQKVFATRDYGAEVVLTGRNFDEAYAAAVQAQEERGALFVHP 145 +A LG+ +T+F P K+ ATR YGAEVVLTG AA + ++ GA+ + P Sbjct: 100 AAKELGIKATIFTPTGVALPKLQATRAYGAEVVLTGDTMIGPLRAASEFAKQTGAVRIPP 159 Query: 146 FDDPLVMAGQGTIGLEVLQELPDVANILVPIGGGGLIAGIATAIRETHP----HVRIIGV 201 FD V+AGQGT+GLE+L ++P+V ++VPIGGGGL+AG+A+ +++ +++IGV Sbjct: 160 FDHHDVVAGQGTVGLEILDQMPEVETVVVPIGGGGLMAGVASVMKQRAALEGRSIKVIGV 219 Query: 202 ETAAAPSAHYSLQKGKIVQVPVTVTLADGIAVKKPGVNTFPIIRDLVDEVVLVEEEEIAL 261 + A S++ GKIV+V V T+ADGIAV KPG F II+ VDEVV V+++E A Sbjct: 220 QATNAAPYPLSIEAGKIVEVSVKPTIADGIAVSKPGELNFDIIKHTVDEVVTVDDDETAR 279 Query: 262 AIVALLERTKLLVEGAGAVPLAALLNRRVTDLSGKTVCVLSGGNIDVKTISVVVERGLVA 321 AI+ LLER K++VE AGAV +AA+++ V +G T +LSGGNID + V+ RGL + Sbjct: 280 AILVLLERAKMVVEPAGAVAVAAVMSGLV-KATGPTAVILSGGNIDPMILERVISRGLAS 338 Query: 322 AGRYLKLKVELDDLPGALARLATEIAEAKANISIITHDRRSKSLPIGKTEVLIELETRGF 381 +GRY+K+++ L D PG LAR + +A+ AN+ + H R L I + E+ + +ETRG Sbjct: 339 SGRYMKMRIPLPDRPGQLARTSEIVADENANVVEVLHTRHGTGLQISQVELELHIETRGP 398 Query: 382 EHIQEVISHLQGVGY 396 EH ++V+ L+ GY Sbjct: 399 EHAEQVLEALRREGY 413 Lambda K H 0.319 0.137 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 419 Length adjustment: 31 Effective length of query: 371 Effective length of database: 388 Effective search space: 143948 Effective search space used: 143948 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_104913117.1 C3B54_RS02615 (threonine ammonia-lyase)
to HMM TIGR01127 (ilvA: threonine ammonia-lyase (EC 4.3.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01127.hmm # target sequence database: /tmp/gapView.944435.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01127 [M=380] Accession: TIGR01127 Description: ilvA_1Cterm: threonine ammonia-lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-141 457.0 2.7 2.8e-141 456.8 2.7 1.0 1 NCBI__GCF_002950575.1:WP_104913117.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_002950575.1:WP_104913117.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.8 2.7 2.8e-141 2.8e-141 1 377 [. 35 414 .. 35 417 .. 0.98 Alignments for each domain: == domain 1 score: 456.8 bits; conditional E-value: 2.8e-141 TIGR01127 1 tpleksstlsditgaevylklenlqktGsfkirGalnkiaklseeekkrGvvaasaGnhaqGvalaakvfgik 73 tp+e s l ++ g v++k enlq+tGs+kirGa+n+++klseee+ rGvvaasaGnhaqGva+aak gik NCBI__GCF_002950575.1:WP_104913117.1 35 TPMEVSRYLEELLGVPVFMKCENLQRTGSYKIRGAFNRMSKLSEEERARGVVAASAGNHAQGVAFAAKELGIK 107 89*********************************************************************** PP TIGR01127 74 akivmPesaplskvkatksyGaeviLhGadfDeayklaeelaeeegrvfvhafdDefviaGqGtlgleiledl 146 a+i P l k++at++yGaev+L G+++ ++a+e+a+++g+v + +fd + v+aGqGt+gleil+++ NCBI__GCF_002950575.1:WP_104913117.1 108 ATIFTPTGVALPKLQATRAYGAEVVLTGDTMIGPLRAASEFAKQTGAVRIPPFDHHDVVAGQGTVGLEILDQM 180 ************************************************************************* PP TIGR01127 147 pdvdtvivPvGGGGLisGvasavkkln....pevkviGveaeaapslveslkegkikavesvktiaDGiavkk 215 p+v+tv+vP+GGGGL++Gvas++k+ +kviGv+a +a s+++gki++v+++ tiaDGiav k NCBI__GCF_002950575.1:WP_104913117.1 181 PEVETVVVPIGGGGLMAGVASVMKQRAalegRSIKVIGVQATNAAPYPLSIEAGKIVEVSVKPTIADGIAVSK 253 ************************976222258**************************************** PP TIGR01127 216 pgdltfeivkelvDevvavdeeeiakaillLlerakivaegaGavgvaavleekvdvkgkkvavvvsGGnidl 288 pg+l+f+i+k++vDevv+vd++e a+ail+Llerak+v+e+aGav+vaav++ v++ g +av++sGGnid+ NCBI__GCF_002950575.1:WP_104913117.1 254 PGELNFDIIKHTVDEVVTVDDDETARAILVLLERAKMVVEPAGAVAVAAVMSGLVKATG-PTAVILSGGNIDP 325 ***********************************************************.899********** PP TIGR01127 289 nllekiiekgLvksgrkvkietvlkDkPGaLkklleviaekranivkiehdrlskeialgaakvelelevkgk 361 +le++i +gL++sgr++k++ l+D+PG+L + e++a+++an+v++ h r + +++++ ++el++e++g+ NCBI__GCF_002950575.1:WP_104913117.1 326 MILERVISRGLASSGRYMKMRIPLPDRPGQLARTSEIVADENANVVEVLHTRHGTGLQISQVELELHIETRGP 398 ************************************************************************* PP TIGR01127 362 ehleellktlrdkgye 377 eh e++l+ lr +gye NCBI__GCF_002950575.1:WP_104913117.1 399 EHAEQVLEALRREGYE 414 ***************7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (380 nodes) Target sequences: 1 (419 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.93 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory