Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_106717340.1 CU100_RS14510 sugar ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_003010935.1:WP_106717340.1 Length = 257 Score = 215 bits (547), Expect = 8e-61 Identities = 118/248 (47%), Positives = 164/248 (66%), Gaps = 1/248 (0%) Query: 3 QEPILTARGLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGE 62 Q P+L+ G KR+G V ALD D++ GEILA++GDNGAGKS++IK ISG D G+ Sbjct: 11 QHPVLSVSGACKRFGSVVALDNVSIDVHRGEILALLGDNGAGKSTLIKCISGVHRLDAGD 70 Query: 63 IRLEGKPIQFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLD 122 + ++G RSP +AR AGIETVYQ+LAL L+ A N F GREI P + R L+ Sbjct: 71 VVIDGAANVLRSPADARLAGIETVYQDLALFDNLTPAQNFFAGREIAGPRWFPRAMRFLN 130 Query: 123 RAAMEKQARAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAAL 182 + M++Q R+ + L +++ +++ V +SGGQRQ +AVAR+A F KVVI+DEPTAAL Sbjct: 131 KRKMDEQTRSLIQSLN-VSLPHLDAVVALMSGGQRQAIAVARSAVFARKVVILDEPTAAL 189 Query: 183 GVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSD 242 G +ESR+VL+LI +R RG I+LI+HNM HV E+A R + R GRR+ + P + Sbjct: 190 GQRESRKVLDLIGALRDRGNAIILITHNMEHVTELACRAVVLRQGRRVGELVPTRDNKQE 249 Query: 243 AVAFMTGA 250 V+ + GA Sbjct: 250 LVSMIVGA 257 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory