Align Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized)
to candidate WP_106719174.1 CU100_RS24140 sugar ABC transporter ATP-binding protein
Query= SwissProt::Q9F9B0 (260 letters) >NCBI__GCF_003010935.1:WP_106719174.1 Length = 267 Score = 202 bits (514), Expect = 6e-57 Identities = 112/247 (45%), Positives = 154/247 (62%), Gaps = 4/247 (1%) Query: 11 GLVKRYGRVTALDRADFDLYPGEILAVIGDNGAGKSSMIKAISGAVTPDEGEIRLEGKPI 70 G+ KRY + LD L PGE+L ++GDNGAGKS++ K +SGAV PD G I ++GK + Sbjct: 15 GISKRYNTIQTLDNVSLSLRPGEVLGLVGDNGAGKSTLSKVLSGAVIPDAGTIEIDGKVV 74 Query: 71 QFRSPMEARQAGIETVYQNLALSPALSIADNMFLGREIRKPGIMGKWFRSLDRAAMEKQA 130 F SP +AR +E VYQ+L+L + +A N+FLGRE R+ I+G F LD+ M +A Sbjct: 75 SFSSPADARSEHVEMVYQDLSLCDTVDVAGNIFLGREPRR-RILGVPF--LDKKRMHDEA 131 Query: 131 RAKLSELGLMTIQNINQAVETLSGGQRQGVAVARAAAFGSKVVIMDEPTAALGVKESRRV 190 RA L LG++ I + VE LSGGQRQ +A+ RAA+F V+IMDEPTAAL V E V Sbjct: 132 RAMLDRLGIV-IADTGLKVENLSGGQRQSIAIGRAASFEPSVLIMDEPTAALAVAEVEAV 190 Query: 191 LELILDVRRRGLPIVLISHNMPHVFEVADRIHIHRLGRRLCVINPKDYTMSDAVAFMTGA 250 L+LI V RG+ ++LI+H + +F V DRI + GR + +D ++ D V + G Sbjct: 191 LDLIRAVSARGVSVILITHRLQDLFLVCDRIQVMYEGRNVAERRIEDTSIEDVVNLIVGR 250 Query: 251 KEPPREA 257 K R A Sbjct: 251 KFQARSA 257 Lambda K H 0.321 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 267 Length adjustment: 25 Effective length of query: 235 Effective length of database: 242 Effective search space: 56870 Effective search space used: 56870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory