GapMind for catabolism of small carbon sources

 

Protein WP_106710281.1 in Phyllobacterium brassicacearum STM 196

Annotation: NCBI__GCF_003010955.1:WP_106710281.1

Length: 333 amino acids

Source: GCF_003010955.1 in NCBI

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
N-acetyl-D-glucosamine catabolism SMc02869 hi N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 77% 95% 509.2 ABC transporter for D-Sorbitol, ATPase component 62% 414.1
D-glucosamine (chitosamine) catabolism SMc02869 hi N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 77% 95% 509.2 ABC transporter for D-Sorbitol, ATPase component 62% 414.1
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 62% 100% 414.1 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 59% 100% 395.6 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
D-maltose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 58% 97% 389.8 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
sucrose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 58% 97% 389.8 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
trehalose catabolism thuK med ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 58% 97% 389.8 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 52% 100% 334.7 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 43% 99% 264.6 N-Acetyl-D-glucosamine ABC transport system, ATPase component 77% 509.2

Sequence Analysis Tools

View WP_106710281.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MGSLKIENIRKSFGHVDVLKGIDLEVKDGEFVIFVGPSGCGKSTLLRVIAGLEDATSGDI
LIDGKKVNNTPPAKRGIAMVFQTYALYPHLSVRDNMGLGLKQAGKPADEIKERTGIASSM
LSLDEYLERRPAELSGGQRQRVAIGRAIVREPQLFLFDEPLSNLDAALRVNTRLEIARLH
RQLKATMIYVTHDQVEAMTLADKIVVLNKGKIEQVGSPMELYNAPQTIFVAGFIGSPQMN
LIDAAKLGQSGAKTIGIRPEHIQVSKTSGEWKGSVIHVEHLGADTIIYLQTDFGPLTVRL
FGEHNYDVDGVLYATPDAGRTYRFDNDGQVIKG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory