Align Alpha-ketoglutarate permease (characterized)
to candidate WP_106712578.1 CU102_RS18560 MHS family MFS transporter
Query= SwissProt::P0AEX3 (432 letters) >NCBI__GCF_003010955.1:WP_106712578.1 Length = 440 Score = 176 bits (446), Expect = 1e-48 Identities = 113/375 (30%), Positives = 187/375 (49%), Gaps = 6/375 (1%) Query: 30 GNLVEWFDFYVY-SFCSLYFAHIFFPSGNTTTQLLQTAGVFAAGFLMRPIGGWLFGRIAD 88 G+ VE++DF++Y + +L F IFF + N + + F ++ RP G + G I D Sbjct: 21 GSAVEYYDFFIYGTAAALIFPEIFFSAENPQAAAIASFATFGVAYIARPFGAVILGHIGD 80 Query: 89 KHGRKKSMLLSVCMMCFGSLVIACLPGYETIGTWAPALLLLARLFQGLSVGGEYGTSATY 148 K GRKK + ++ +M F + +I CLP Y+ +G AP LL++ARL QG+S GE + + Sbjct: 81 KFGRKKVLTFTLLLMGFSTFIIGCLPTYDHVGILAPILLVVARLLQGVSAAGEQAGANSM 140 Query: 149 MSEVAVEGRKGFYASFQYVTLIGGQLLALLVVVVLQHTMEDAALREWGWRIPFALGAVLA 208 E A R+ F+ SF G +LA LV + + + +A L W WRIPF L V+ Sbjct: 141 TLEHAPPNRRAFFTSFTLSGTQAGLILATLVFIPIS-KLPEADLLSWAWRIPFFLSLVVV 199 Query: 209 VVALWLRRQLDETS--QQETRALKEAG-SLKGLWRNRRAFIMVLGFTAAGSLCFYTFTTY 265 VV W+RR L ET +ET+ + A L+ N A ++ + F A S+ F+ + Sbjct: 200 VVGFWVRRTLPETPVFLEETKKHETAEVPFVMLFSNHWADVLRIIFAALISVVSTIFSVF 259 Query: 266 MQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIGALSDKIGRRTSMLCFGSLAAIFTVP 325 Y VNT + + ++ A V + PL +L+D++GR+ + A+ P Sbjct: 260 TLSYAVNTMQIDRSTMLTVLVLANLVALGAIPLWASLADRVGRKPIFILGALGCAVLIWP 319 Query: 326 ILSALQNVSSPYAAFGLVMCALLIVSFYTSISGILKAEMFPAQVRALGVGLSYAVANAIF 385 + A+ + P ++ + ++ S + L EMF +VR G+ + + A+ Sbjct: 320 YIWAISQGNLPLIFVVGILLSGIVYSASNGVWPALYGEMFDTRVRLSGMAIGTQIGFAL- 378 Query: 386 GGSAEYVALSLKSIG 400 GG A ++ +L G Sbjct: 379 GGFAPTISAALLGTG 393 Lambda K H 0.328 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 440 Length adjustment: 32 Effective length of query: 400 Effective length of database: 408 Effective search space: 163200 Effective search space used: 163200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory