Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate WP_106713055.1 CU102_RS21030 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc02871 (279 letters) >NCBI__GCF_003010955.1:WP_106713055.1 Length = 350 Score = 149 bits (377), Expect = 6e-41 Identities = 78/225 (34%), Positives = 132/225 (58%), Gaps = 2/225 (0%) Query: 55 TFSLIGYETVLKQGDFIGYFQNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYL 114 +F+ Y DF+ Y NS+ VTVV+ + L+ +MAAFALS+Y FRG T+ L + Sbjct: 128 SFASENYTGPFTHFDFVRYLWNSVFVTVVATLITLIVNSMAAFALSKYEFRGRTIAMLLI 187 Query: 115 ALGIMIPIRLGTVAILQGMVATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKN 174 +M+P+ + V + + A GL N+L +IL A P VFIL ++M T+ D+L + Sbjct: 188 LATLMVPLSVIMVPLYSIVSALGLFNSLWGVILPTVAT--PTGVFILRQYMLTIPDELID 245 Query: 175 AGRIDGLSEYAIFLRLVLPLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQ 234 A R+D SE+ I+ R++LPL PA+A +A+F+++ WND +PLI+ + T+ +G Sbjct: 246 AARMDKASEWQIYWRIILPLTAPALAVLAIFSVVWRWNDFLWPLIVLSRKELYTLQVGLS 305 Query: 235 IFIGQFVTNWNAVLSALSLAIFPVLVLYVIFSRQLIRGITAGAVK 279 I+ G+ W+ +L+ + + PV+++++ R + GI +K Sbjct: 306 IYSGELNVQWHFILAMTVVTMIPVVLVFIFLQRFITTGIAGTGLK 350 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 350 Length adjustment: 27 Effective length of query: 252 Effective length of database: 323 Effective search space: 81396 Effective search space used: 81396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory