Align Glucose kinase (characterized, see rationale)
to candidate WP_106712464.1 CU102_RS17890 glucokinase
Query= uniprot:Q8P6S9 (338 letters) >NCBI__GCF_003010955.1:WP_106712464.1 Length = 342 Score = 157 bits (396), Expect = 5e-43 Identities = 95/314 (30%), Positives = 151/314 (48%), Gaps = 6/314 (1%) Query: 19 VAADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLAEIMAAFFAELSCAPVRRG 78 + D+GGT+ R A+ ++ K ++ + ADYP + E + + + R Sbjct: 16 LVGDIGGTNARFAILVDAYAEPKEFPII-----QTADYPTIDEAIQNAILDHTSIQPRSA 70 Query: 79 VIASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVNDFEAVAYAANYMTGNQVMQ 138 V+A AG +E + N WV+ P Q+ + LG+ + ++NDFEA A A + + + Sbjct: 71 VLAIAG-PVEGDEIDLTNCAWVVKPRQMMETLGLSDITVLNDFEAQALAVVSLEPKHLEK 129 Query: 139 LSGPAQGAPGPALVLGPGTGLGAALWIPNGGNSVVLPTEAGHAALAAASDLEVALLQELR 198 L G G VLGPGTGLG A + + + V +P E GH + + ++ L + Sbjct: 130 LGGGPGDPHGSRAVLGPGTGLGVAGMVRSRNSWVPVPGEGGHVDMGPRTARDLELFPHIE 189 Query: 199 RTRTHVATEHFLSGPGLLTLYTALATLRDAPAVHATPAAVTAAALAGDDVLAHEALQTFC 258 ++ E L G GL +Y A+ + PA TPA +TAA L+G+ A E L F Sbjct: 190 HIEGRISGEQLLCGRGLQNIYRAICKVNGTPASLQTPAEITAAGLSGESAEAKETLALFV 249 Query: 259 GFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAARLLDKGPLRPALEQVPVRI 318 ++G + GD L + R GVYLAGG + +I + F DK P L + PV I Sbjct: 250 VYLGRLAGDFALTFMARGGVYLAGGIVQKIVAPLKDPSFRQAFEDKAPHGEILRETPVYI 309 Query: 319 VEHGQLGVIGAASW 332 + H + G +++ Sbjct: 310 ITHPLAALSGLSAF 323 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 342 Length adjustment: 28 Effective length of query: 310 Effective length of database: 314 Effective search space: 97340 Effective search space used: 97340 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory