Align Xylose/arabinose import permease protein XacH (characterized, see rationale)
to candidate WP_106712565.1 CU102_RS18495 sugar ABC transporter permease
Query= uniprot:D4GP36 (317 letters) >NCBI__GCF_003010955.1:WP_106712565.1 Length = 292 Score = 159 bits (403), Expect = 6e-44 Identities = 98/278 (35%), Positives = 151/278 (54%), Gaps = 10/278 (3%) Query: 40 GIPFVLMSIAVYGGTGYNFAISFTDYEGLGTPDYSTLDLEMYAQALSSDAFIAAAQNNLV 99 G F+++ I VYG Y +SFTD + L P Y + LE Y + + + A N + Sbjct: 17 GPSFLIVLIFVYGFIAYTGLLSFTDSKML--PSYGFVGLENYRKLWALPHWWRAITNLGI 74 Query: 100 LLVGFTTICLVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGIL 159 + IC V+GL LAILLD IR + +YL PM+LSF+VT W W + G+ Sbjct: 75 FASLYIIICTVIGLGLAILLDQKIRIEGFLRPIYLYPMALSFIVTGVAWKWFLDPGIGLE 134 Query: 160 NLVVT----TLGFNPVDWLGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAA 215 N + + FN W+ + ++A+ V++A +WQ SG+ M ++LAGL+ + ++ +AA Sbjct: 135 NTMHQWGWESFSFN---WIKDRNMAIYTVVIAAVWQSSGFVMAMFLAGLRGVDNEIIKAA 191 Query: 216 RVDGASITRTYLRIIVPQLKEASVSAAVVLMVFALKAFTFLYALVGRYRPPNGTDILATL 275 ++DGAS Y RII+P ++ +SA VVL A+KA+ + AL G P T++ AT Sbjct: 192 QIDGASTGMIYRRIIIPLMRPVFLSAFVVLAHLAIKAYDLVIALTGG-GPGQATELPATF 250 Query: 276 MVRRAFKFGEWAYSAAIATMLLIMALGVIGPYLYYQYK 313 M F A+ A ++LIM +I PYLY + + Sbjct: 251 MYSYTFTRNSMGIGASSAIIMLIMIFSIIIPYLYSEVR 288 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 292 Length adjustment: 27 Effective length of query: 290 Effective length of database: 265 Effective search space: 76850 Effective search space used: 76850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory