Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate WP_106713055.1 CU102_RS21030 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >NCBI__GCF_003010955.1:WP_106713055.1 Length = 350 Score = 113 bits (283), Expect = 6e-30 Identities = 62/210 (29%), Positives = 115/210 (54%), Gaps = 5/210 (2%) Query: 96 RGFWNSVRITVPSVIISIAIASVNGYALANWRFKGADLFFTILIVGAFIPYQVMIYPIVI 155 R WNSV +TV + +I++ + S+ +AL+ + F+G + +++ +P V++ P+ Sbjct: 145 RYLWNSVFVTVVATLITLIVNSMAAFALSKYEFRGRTIAMLLILATLMVPLSVIMVPLYS 204 Query: 156 VLREMGVYGTLTGLIIVHTIFGMPILTLLFRNYFAGLPEELFKAARVDGAGFWTIYFKIM 215 ++ +G++ +L G+I+ P + R Y +P+EL AAR+D A W IY++I+ Sbjct: 205 IVSALGLFNSLWGVIL--PTVATPTGVFILRQYMLTIPDELIDAARMDKASEWQIYWRII 262 Query: 216 LPMSLPIFVVAMILQVTGIWNDFLFG-VVFTRPEYYPMTVQLNNIVNSVQGVKEYNVNMA 274 LP++ P V I V WNDFL+ +V +R E Y T+Q+ + S + +++ +A Sbjct: 263 LPLTAPALAVLAIFSVVWRWNDFLWPLIVLSRKELY--TLQVGLSIYSGELNVQWHFILA 320 Query: 275 ATILTGLVPLTVYFVSGRLFVRGIAAGAVK 304 T++T + + V+ R GIA +K Sbjct: 321 MTVVTMIPVVLVFIFLQRFITTGIAGTGLK 350 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 350 Length adjustment: 28 Effective length of query: 277 Effective length of database: 322 Effective search space: 89194 Effective search space used: 89194 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory