Align Binding-protein-dependent transport systems inner membrane component (characterized, see rationale)
to candidate WP_106713055.1 CU102_RS21030 carbohydrate ABC transporter permease
Query= uniprot:A3DHA2 (303 letters) >NCBI__GCF_003010955.1:WP_106713055.1 Length = 350 Score = 122 bits (306), Expect = 1e-32 Identities = 79/230 (34%), Positives = 121/230 (52%), Gaps = 5/230 (2%) Query: 78 KLIPDMVSMKQYYTVLFRKPTFLLMFLNSAIMTIPIVIIQVIVGVFAAYAFAKLRFPLRD 137 K + +M + YT F F+ NS +T+ +I +IV AA+A +K F R Sbjct: 122 KPVREMSFASENYTGPFTHFDFVRYLWNSVFVTVVATLITLIVNSMAAFALSKYEFRGRT 181 Query: 138 KLFFVFIVVMLMPLQVTLVPNYILLRKLDMIGSFLSVILPGGFSAFGVVLLRQYMRGIPD 197 + + +++PL V +VP Y ++ L + S VILP + GV +LRQYM IPD Sbjct: 182 IAMLLILATLMVPLSVIMVPLYSIVSALGLFNSLWGVILPTVATPTGVFILRQYMLTIPD 241 Query: 198 ECCEAAMIDGAGYLKTFTKIILPQCKSIIASLAILAFIDNWNMVEQPLIFLSDSAKYPLS 257 E +AA +D A + + +IILP +A LAI + + WN PLI LS Y L Sbjct: 242 ELIDAARMDKASEWQIYWRIILPLTAPALAVLAIFSVVWRWNDFLWPLIVLSRKELYTLQ 301 Query: 258 VYLAYINEGDLGLAF----ASGVLYMIPTVLIYLYGEKYFVEGIQLTGIK 303 V L+ I G+L + + A V+ MIP VL++++ +++ GI TG+K Sbjct: 302 VGLS-IYSGELNVQWHFILAMTVVTMIPVVLVFIFLQRFITTGIAGTGLK 350 Lambda K H 0.331 0.147 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 350 Length adjustment: 28 Effective length of query: 275 Effective length of database: 322 Effective search space: 88550 Effective search space used: 88550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory