Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_106710773.1 CU102_RS07735 ABC transporter ATP-binding protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_003010955.1:WP_106710773.1 Length = 272 Score = 307 bits (786), Expect = 2e-88 Identities = 145/246 (58%), Positives = 199/246 (80%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 + +++LHKR+G+ EVLKGVS+ A GDV+++IG SGSGKSTFLRCIN LE P +G I +N Sbjct: 23 IHIENLHKRFGALEVLKGVSMSAKDGDVVAMIGGSGSGKSTFLRCINFLENPTSGVIRIN 82 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 E++K+V++ G A+ +Q++R+RSRL MVFQ+FNLW HMT ++N++E PVHVLGM + Sbjct: 83 GEDVKMVSDGHGGQVPANRRQIERIRSRLGMVFQNFNLWQHMTLIQNVIEVPVHVLGMKR 142 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 EA E L +VG++ ++D YP +MSGG+QQR AIARALA++P VMLFDEPTSALDPE Sbjct: 143 DEAMAIGEQLLERVGLSAKRDVYPAYMSGGQQQRGAIARALAIQPRVMLFDEPTSALDPE 202 Query: 184 LVGDVLKVMQALAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVLVNPQSE 243 LVG+VLKV+ LA+EGRTM++VTHEM FAREV++ +++LH G+VEE G P ++ +P+SE Sbjct: 203 LVGEVLKVIADLAKEGRTMLLVTHEMKFAREVASHVMYLHNGIVEEEGPPEQLFGSPKSE 262 Query: 244 RLQQFL 249 RL+QF+ Sbjct: 263 RLKQFI 268 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 272 Length adjustment: 25 Effective length of query: 229 Effective length of database: 247 Effective search space: 56563 Effective search space used: 56563 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory