Align ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale)
to candidate WP_106710063.1 CU102_RS05665 ABC transporter permease
Query= uniprot:A0A1N7U128 (237 letters) >NCBI__GCF_003010955.1:WP_106710063.1 Length = 278 Score = 131 bits (330), Expect = 1e-35 Identities = 87/232 (37%), Positives = 127/232 (54%), Gaps = 8/232 (3%) Query: 2 IELFQQYGLAYLFSDGAGLSGVAMTLWLFIISVVLGFFLSIPLALARVSEHVWLRWPVEV 61 IEL ++YG YL SG+ T+ L S++LG LSIP+ L R+S++ + Sbjct: 54 IELVKKYGPTYL-------SGLGTTITLVGSSIILGAVLSIPVVLGRLSKNRIIASIAYF 106 Query: 62 YTYLFRGTPLYIQLLICYTGLYSLEIVQDNALLNQFFRNALNCTLLAFVLNTCAYTVEIF 121 Y Y FRGTPL Q+ + Y G+ S + L FFR A C LLAF LNT AY EI Sbjct: 107 YVYFFRGTPLIAQVFLIYYGVGSFSKELQSVGLWIFFREAWFCALLAFGLNTAAYQAEIL 166 Query: 122 AGAIRNIPHGEIEAARAYGLHGWRLNLFVVVPAALRRALPAYSNEMILMLHATSLAFTAT 181 GAIR++P G+ E A + G+ +++P AL AL Y NE+ILM+ +++ + Sbjct: 167 RGAIRSVPLGQWEGAASLGISKSVTFRKIILPQALIVALRPYGNEVILMIKGSAIVALIS 226 Query: 182 VADILKVARDANAETFLTFQAFGIAALLYMLLSFALVGLFRLAERRWMRFLV 233 V D++ + A + TF FQ + A++Y++L L L+ ERR R L+ Sbjct: 227 VYDLMGYTKLAYSRTF-DFQTYLWTAIIYLILVEILRHLWDWMERRITRHLI 277 Lambda K H 0.332 0.143 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 278 Length adjustment: 24 Effective length of query: 213 Effective length of database: 254 Effective search space: 54102 Effective search space used: 54102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory