Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate WP_106713291.1 CU102_RS22245 aspartate aminotransferase family protein
Query= reanno::pseudo3_N2E3:AO353_08585 (454 letters) >NCBI__GCF_003010955.1:WP_106713291.1 Length = 442 Score = 277 bits (708), Expect = 6e-79 Identities = 165/441 (37%), Positives = 247/441 (56%), Gaps = 28/441 (6%) Query: 13 TLSSEHHLAPFSDFKQLKEKGPRIITNAKGVYLWDSEGNKILDGMAGLWCVAIGYGRDEL 72 T S E++ PF+ +Q K PR++ AKG+Y D +G ++LDG AGLWCV G+GR+++ Sbjct: 6 TPSLENYWMPFTANRQFKT-APRLLAAAKGMYYTDVDGGQVLDGTAGLWCVNAGHGREKI 64 Query: 73 ADAASKQMRELPYYNLFFQTAHPPVLELAKAISDIAP----EGMNHVFFTGSGSEGNDTM 128 ADA ++Q+ + Y F Q HP V + A+ ++ AP G+ VFFTGSGSE DT Sbjct: 65 ADAVARQLMTMDYAPSF-QMGHPMVFDFAEKLAARAPGGKQSGLTKVFFTGSGSESVDTA 123 Query: 129 LRMVRHYWAIKGQPNKKVIISRINGYHGSTVAGASLGGMTYMHEQGDLPIPGIVHI---- 184 L++ Y GQ + +I R GYHG G S+GG+ L +PG+ H+ Sbjct: 124 LKIAIAYQRSIGQGTRTRVIGRERGYHGVGFGGISVGGLVNNRRAFPL-LPGVDHLRHTH 182 Query: 185 -PQPYWFGEGGDMTPEEFGIWAANQLEEKILELGVDTVGAFIAEPIQGAGGVIIPPDSYW 243 P F +G E+G A+ LE + G +T+ A I EP+ G+ GV++PP Y Sbjct: 183 DPVRNSFVKG----LPEYGADLADDLERLVALHGAETIAAVIVEPVAGSTGVLLPPKGYL 238 Query: 244 PRIKEILAKYDILFVADEVICGFGRTGEWFGSDFYGLKPDMMTIAKGLTSGYIPMGGLIV 303 R++ I K+ IL + DEVI GFGR G F D++G+ PD++T AKGLT+G +PMG + Sbjct: 239 ERLRTISKKHGILLIFDEVITGFGRLGTPFAVDYFGVVPDLVTTAKGLTNGALPMGAVFA 298 Query: 304 RDEVVEVLNEGGDFN----HGFTYSGHPVAAAVALENIRILREEKIIEHVRAETAPYLQK 359 + + + L G + HG+TYSGHP A A L + I EE ++ E A + Q Sbjct: 299 SETIYDALMNGPESQIELFHGYTYSGHPAACAAGLATLEIYEEEGLLTRA-GELADHWQD 357 Query: 360 RLRELNDHPLVGEVRGVGLLGAIELVQDKATRARYVG-KGVGMICRQFCFDNGLIMRAVG 418 + L + ++R +GL+ IEL ++R VG +G + CF GL++R G Sbjct: 358 AMHSLKGLANIIDIRTIGLVAGIEL----SSRPDAVGARGYDIFVD--CFKRGLLVRVTG 411 Query: 419 DTMIIAPPLVITKAEIDELVT 439 DT+ ++PPL++ K +ID LV+ Sbjct: 412 DTIALSPPLIVEKDQIDMLVS 432 Lambda K H 0.320 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 522 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 442 Length adjustment: 33 Effective length of query: 421 Effective length of database: 409 Effective search space: 172189 Effective search space used: 172189 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory