Align Lysine/ornithine decarboxylase; LDC; EC 4.1.1.17; EC 4.1.1.18 (uncharacterized)
to candidate WP_106714464.1 CU102_RS29060 type III PLP-dependent enzyme
Query= curated2:O50657 (393 letters) >NCBI__GCF_003010955.1:WP_106714464.1 Length = 377 Score = 207 bits (527), Expect = 4e-58 Identities = 128/354 (36%), Positives = 189/354 (53%), Gaps = 13/354 (3%) Query: 21 PFLVASLDKVEENYQFMRRHLPRAGVFYAMKANPTPEILSLLAGLGSHFDVASAGEMEIL 80 P +V L+ V EN+ LP + +FYA+KANP PEIL LLA LGS FD AS E+E+ Sbjct: 18 PCMVLDLEVVRENFHNFEMALPESKIFYAVKANPAPEILRLLASLGSSFDTASVAEVEMA 77 Query: 81 HELGVDGSQMIYANPVKDARGLKAAADYNVRRFTFDDPSEIDKMAKAVPGADVLVRIAVR 140 + G ++ + N +K R + A + +R F D E++K+A+A PG+ V R+ Sbjct: 78 LDAGATADRISFGNTIKKERDIARAFELGIRLFAVDCVEEVEKVARAAPGSRVFCRVLTD 137 Query: 141 NNKALVDLNTKFGAPVEEALDLLKAAQDAGLHAMGICFHVGSQSLSTAAYEEALLVARRL 200 A L+ KFG A+D+L+AAQ GL + G+ FHVGSQ AA++ AL A+++ Sbjct: 138 GAGAEWPLSRKFGCVPAMAVDVLRAAQKLGLESYGVSFHVGSQQTDLAAWDRALGDAKQV 197 Query: 201 FDEAEEMGMHLTDLDIGGGFPVPDAKGLNVDLA---AMMEAINKQIDRLFPDTAVWTEPG 257 FD G+ L +++GGGFP K + A A+ +A++K P+T + EPG Sbjct: 198 FDTLALEGITLKMVNMGGGFPTRYLKDVPTAQAYGQAIFQALSKHFGNRLPETII--EPG 255 Query: 258 RYMCGTAVNLVTSVIGTKTRGEQP---WYILDEGIYGCFSGIMYDHWTYPLHCFGKGNK- 313 R M G A + V+ + + W LD G +G + M + Y + G++ Sbjct: 256 RGMVGNAGVIKAEVVLVSKKADNDNVRWVYLDIGKFGGLAETMDEAIRYQITTPRDGDRA 315 Query: 314 KPSTFGGPSCDGIDVLYRDFMAP---ELKIGDKVLVTEMGSYTSV-SATRFNGF 363 +P GP+CD DV+Y P L IGD+VL+ G+YT+ SA FNGF Sbjct: 316 EPCVLAGPTCDSADVMYEKNPYPLPLSLTIGDEVLIEGTGAYTTTYSAVAFNGF 369 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 370 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 377 Length adjustment: 30 Effective length of query: 363 Effective length of database: 347 Effective search space: 125961 Effective search space used: 125961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory