Align 4-hydroxybutyrate-CoA ligase (EC 6.2.1.40) (characterized)
to candidate WP_106712922.1 CU102_RS20310 AMP-binding protein
Query= BRENDA::A4YDR9 (549 letters) >NCBI__GCF_003010955.1:WP_106712922.1 Length = 537 Score = 182 bits (463), Expect = 2e-50 Identities = 148/528 (28%), Positives = 242/528 (45%), Gaps = 38/528 (7%) Query: 27 FLERAGKYFKDKTAVVYRDSRYTYSTFYDNVMVQASALMRR-GFSREDKLSFISRNRPEF 85 FL ++ K F D+ A+V+ + +T++ V A+AL + G D++ S+N + Sbjct: 22 FLVQSAKRFPDEVALVWGEQSWTWAQMLRRVNAMAAALQKEFGVVMGDRILVQSQNCNQM 81 Query: 86 LESFFGVPYAGGVLVPINFRLSPKEMAYIINHSDSKFVVVDEPYLNSLLEVKDQIKAEII 145 ES F G V VP NFR +P E+AY+ S +K ++ + + + Sbjct: 82 FESMFACFKLGAVWVPTNFRQTPDEVAYLARASGAKGMICGRLFPEHV---------DAC 132 Query: 146 LLEDPDNPSASETARKEVRMTYRELVKGGSRDPLPIPAKEEYSMITLYYTSGTTGLPKG- 204 + PD + Y +V + + + E ++TSGTTG PK Sbjct: 133 RVASPDLKFVVAIGKAGFGDDYDAIVDRFDGEMVAMAPVEHCDPCWFFFTSGTTGRPKAA 192 Query: 205 VMHHHRGAFLNAMAEVLEHQMDL------NSVYLWTLPMFHAASWGFSWAT-VAVGATNV 257 V+ H + F+ V H DL L P+ H A G T VA GA + Sbjct: 193 VLTHGQMGFV-----VTNHLCDLMPGTTHKDASLVVAPLSHGA--GIHQLTQVARGAKTI 245 Query: 258 CL--DKVDYPLIYRLVEKERVTHMCAAPTVYVNLADYMKRNNLKFSNRVHMLVAGAAPAP 315 L +K D +RL+EK +V++M PT+ L ++ S+ H++ AGA P Sbjct: 246 LLPTEKFDIAEAWRLIEKWQVSNMFTVPTILKMLTEHPDAQTRDHSSLRHVIYAGA-PMY 304 Query: 316 AT--LKAMQEIGGYMCHVYGLTETYGPHSICEWRREWDSLPLEEQAKLKARQ-GIPYVSF 372 T ++A+Q +G + +GL E G ++ LE+ + + G Sbjct: 305 RTDQVRALQTLGPVIVQYFGLGEVTGNITVLPPAEHH----LEDGPETRVGTCGYARTGM 360 Query: 373 EMDVFDANGKPVPWDGKTIGEVVMRGHNVALGYYKNPEKTAESFRDGWFHSGDAAVVHPD 432 ++ + D G+ VP T GE+ + G V GYY NPE A++FR GWF +GD + Sbjct: 361 QISIQDDEGREVP--PGTTGEICVIGPAVFAGYYNNPEANAKAFRHGWFRTGDLGHMDDA 418 Query: 433 GYIEIVDRFKDLINTGGEKVSSILVEKTLMEIPGVKAVAVYGTPDEKWGEVVTARIELQE 492 G++ I R D+ +GG V + +E+ ++ P + AV G PD WGEV A + Sbjct: 419 GFLFITGRASDMYISGGSNVYPLEIEEKILAHPDISEAAVLGIPDPMWGEVGLAVCVARP 478 Query: 493 GVKLTEEEVIKFCKERLAHFECPKIVEFGP-IPMTATGKMQKYVLRNE 539 G E ++ + ++AH++ PK + F P +P +A GK+ K ++R E Sbjct: 479 GTAPDPEAIMAWLSGKMAHYKLPKRLVFWPEMPKSAYGKIAKKLVREE 526 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 653 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 549 Length of database: 537 Length adjustment: 35 Effective length of query: 514 Effective length of database: 502 Effective search space: 258028 Effective search space used: 258028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory