Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate WP_106712544.1 CU102_RS18370 SDR family oxidoreductase
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >NCBI__GCF_003010955.1:WP_106712544.1 Length = 250 Score = 124 bits (310), Expect = 3e-33 Identities = 84/253 (33%), Positives = 128/253 (50%), Gaps = 13/253 (5%) Query: 7 LRPTPGLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGVA-D 65 +R G +I+G A+GIG A+ + G V I DVD A ID A+ A GV D Sbjct: 5 IRRYEGRHAVITGGASGIGFKTAERIVSEGGTVSIWDVDAAKIDEAKNALGDAAHGVRLD 64 Query: 66 VSDCAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFL 125 V+D QV R + G +D+L+ +AGI GP V D EW+R NL+ FY Sbjct: 65 VADPDQVARAAQETAKAYGKIDVLVCSAGITGPNAKVADYPIDEWKRVFDINLHGLFYCN 124 Query: 126 RKAVPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVN 185 R VP++++ S I+ +AS+AG+ G + Y+ASK A++G+ KSL EL + + VN Sbjct: 125 RFVVPIMQK-SGYGRIVNVASIAGKEGNPNASAYSASKAAVIGLTKSLGKELVHDGITVN 183 Query: 186 AILPGVVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPA 245 AI P VE + ++ + + L KI ++R V ++AA+ ++AS Sbjct: 184 AITPATVETPILKQLQQNFIDYM-----------LSKIPMQRFGKVEELAALITWIASEE 232 Query: 246 GQNISGQAISVDG 258 +G + G Sbjct: 233 CSFTTGAVFDISG 245 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 250 Length adjustment: 24 Effective length of query: 239 Effective length of database: 226 Effective search space: 54014 Effective search space used: 54014 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory