Align Galactofuranose-binding protein YtfQ (characterized)
to candidate WP_106712861.1 CU102_RS19525 ABC transporter substrate-binding protein
Query= SwissProt::P39325 (318 letters) >NCBI__GCF_003010955.1:WP_106712861.1 Length = 318 Score = 438 bits (1127), Expect = e-128 Identities = 221/317 (69%), Positives = 258/317 (81%), Gaps = 1/317 (0%) Query: 3 KRLLIVSAVSAAMSSMALAAPLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIADGQ 62 KR+L+ S V+ + + A A+ LTVGFSQ+GSESGWRAAET+V+K EA+KR I LKIAD Q Sbjct: 2 KRILLASTVAMSFAGAASASDLTVGFSQIGSESGWRAAETSVSKIEAKKRSIDLKIADAQ 61 Query: 63 QKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSLY 122 QKQENQIKA+R FVAQGVDAIF+APVVATGW+ VL EAK+AEIPV LLDR+I+ + LY Sbjct: 62 QKQENQIKAIRGFVAQGVDAIFVAPVVATGWDTVLAEAKEAEIPVILLDRTIETANNDLY 121 Query: 123 MTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPNIK 182 +T VT+D + EGK+ GDWLVK GKPCNVVELQGTVG+S AI+RKKGF E I +A NIK Sbjct: 122 LTAVTSDTVHEGKVAGDWLVKTTAGKPCNVVELQGTVGSSPAINRKKGFEEGIASASNIK 181 Query: 183 IIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGKDI 242 I RSQ+GDFTR+KGKEVME F+KAEN GKNIC +YAHNDDM +GAIQAIKEAGLKPGKDI Sbjct: 182 ITRSQTGDFTRAKGKEVMEGFLKAENGGKNICALYAHNDDMAVGAIQAIKEAGLKPGKDI 241 Query: 243 LTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTLYL 302 L SID VPDI+KAM +GEANA+VELTPNMAGPAFDAL+ YK G P K T+S LY Sbjct: 242 LVVSIDAVPDIFKAMSEGEANATVELTPNMAGPAFDALKAYKDSGKAPPKWIQTESKLYT 301 Query: 303 -PDTAKEELEKKKNMGY 318 D K+ E+KK +GY Sbjct: 302 QADDPKKVYEEKKGLGY 318 Lambda K H 0.313 0.130 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 318 Length adjustment: 27 Effective length of query: 291 Effective length of database: 291 Effective search space: 84681 Effective search space used: 84681 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory