Align glucokinase (EC 2.7.1.1; EC 2.7.1.2; EC 2.7.1.8) (characterized)
to candidate WP_106712464.1 CU102_RS17890 glucokinase
Query= ecocyc::GLUCOKIN-MONOMER (321 letters) >NCBI__GCF_003010955.1:WP_106712464.1 Length = 342 Score = 210 bits (534), Expect = 5e-59 Identities = 119/311 (38%), Positives = 170/311 (54%), Gaps = 3/311 (0%) Query: 6 LVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSL-EAVIRVYLEEHKVEVKDGCIAIA 64 LVGD+GGTNAR A+ A E + DYP++ EA+ L+ ++ + +AIA Sbjct: 16 LVGDIGGTNARFAILVDAYAEPKEFPIIQTADYPTIDEAIQNAILDHTSIQPRSAVLAIA 75 Query: 65 CPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEP 124 P+ GD + +TN W +M + LG S + ++NDF A ++A+ L+ +HL + GG Sbjct: 76 GPVEGDEIDLTNCAWVVKPRQMMETLGLSDITVLNDFEAQALAVVSLEPKHLEKLGGGPG 135 Query: 125 VEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHV 184 AV G GTGLGVA +V WV +PGEGGHVD P + + + + G + Sbjct: 136 DPHGSRAVLGPGTGLGVAGMVRSRNSWVPVPGEGGHVDMGPRTARDLELFPHIEHIEGRI 195 Query: 185 SAERVLSGPGLVNLYRAIVKADNRLPENLK-PKDITERALADSCTDCRRALSLFCVIMGR 243 S E++L G GL N+YRAI K N P +L+ P +IT L+ + + L+LF V +GR Sbjct: 196 SGEQLLCGRGLQNIYRAICKV-NGTPASLQTPAEITAAGLSGESAEAKETLALFVVYLGR 254 Query: 244 FGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDN 303 G+ AL GGV++AGGIV + + K FR AFEDK E + + PVY+I H Sbjct: 255 LAGDFALTFMARGGVYLAGGIVQKIVAPLKDPSFRQAFEDKAPHGEILRETPVYIITHPL 314 Query: 304 PGLLGSGAHLR 314 L G A R Sbjct: 315 AALSGLSAFSR 325 Lambda K H 0.322 0.141 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 342 Length adjustment: 28 Effective length of query: 293 Effective length of database: 314 Effective search space: 92002 Effective search space used: 92002 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory