Align Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate WP_106712918.1 CU102_RS20290 carbohydrate ABC transporter substrate-binding protein
Query= uniprot:A0A165KPY4 (416 letters) >NCBI__GCF_003010955.1:WP_106712918.1 Length = 414 Score = 240 bits (612), Expect = 7e-68 Identities = 147/407 (36%), Positives = 214/407 (52%), Gaps = 13/407 (3%) Query: 7 IAAVAVG--LAAAMSASAGEVEVLHYWTSGGEAKSVAELKKIMQGKG-HTWRDFAVAGGG 63 +AA+A L AA A A ++EV H+WTSGGEA + L + G W D A+AG G Sbjct: 7 VAALATSTFLFAAGHAGATDIEVTHWWTSGGEAAAAKVLAESYDKLGGDKWVDGAIAGSG 66 Query: 64 GDSAMTVLKSRVISGNPPSAAQTK-GPAIQEWASEGVLANMDTLAKAEKW-DELLPKVVA 121 +A ++ SR++ GNP A Q G ++ G++ ++ LA E W D + P + Sbjct: 67 -TTARPIIVSRILGGNPMGATQLNTGRDAEDLVKAGLMTDLTELATKEGWADFIRPSKLL 125 Query: 122 DVMKYKGAYVAAPVNVHRVNWMWGSSEALKKAGVAAMPKTWDEFFAAADKLKAAGLVPVA 181 D KY+G PVN+H WMW + A K+AG AA P W+EF AAA +LK G++P+A Sbjct: 126 DACKYEGKIYCVPVNIHSWQWMWINPNAFKEAGAAA-PTNWNEFVAAAPQLKEKGIIPLA 184 Query: 182 HGGQNWQDFTTFESVVLGVGGAKFYQDALVKLDNTALTSDTMKKSLETFRRIKGYTDPGA 241 G WQ F ++ +GG + Y + K D A S M + F + DPG Sbjct: 185 TGDA-WQVDGIFRVILATLGGKELYLKIMDKKDKDAAASPEMTAVWQAFANARDLADPGY 243 Query: 242 PGRDWNLATAMLIQGKAGFQLMGDWAKGEFLAAGKAPGKDFLCAAAPGSANAFTFNVDSF 301 GR WN AT++++ GKAG Q+MGDWA+GEF AGK G D+ C G D+F Sbjct: 244 VGRQWNEATSLVLTGKAGGQIMGDWAQGEFGLAGKVAGTDYDCLPGLGVNPVLDTGGDAF 303 Query: 302 ILFKLKDAAAQKAQSDLASSIMSPAFQEVFNLNKGSIPVRAGQPMDKFDDCAKASAKDFV 361 K KD +AQ LAS ++S Q FNL KGS+P+R M+ + C + K Sbjct: 304 YFPKNKDPEVTRAQLKLASMLVSKETQVAFNLAKGSLPIRGDIDMEAANACMQKGIKILA 363 Query: 362 DTAKSGGLVPSAAHGMAIAPATEGAIKDVVSQFWNDDKVSVADAMKK 408 D ++PS A++ +G ++D+ ++F+ + +SV DA + Sbjct: 364 D---GNNVLPSIE--QALSSDAQGQLEDLNTEFFANKDMSVEDAQAR 405 Lambda K H 0.315 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 511 Number of extensions: 33 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 414 Length adjustment: 31 Effective length of query: 385 Effective length of database: 383 Effective search space: 147455 Effective search space used: 147455 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory